KEGG   Mus musculus (mouse): 17474
Entry
17474             CDS       T01002                                 

Gene name
Clec4d, Clecsf8, Mpcl, mcl
Definition
(RefSeq) C-type lectin domain family 4, member d
  KO
K10058  C-type lectin domain family 4 member D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    17474 (Clec4d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    17474 (Clec4d)
   04090 CD molecules [BR:mmu04090]
    17474 (Clec4d)
   04091 Lectins [BR:mmu04091]
    17474 (Clec4d)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   17474 (Clec4d)
CD molecules [BR:mmu04090]
 Proteins
  17474 (Clec4d)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    17474 (Clec4d)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 17474
NCBI-ProteinID: NP_034949
MGI: 1298389
Ensembl: ENSMUSG00000030144
Vega: OTTMUSG00000056550
UniProt: Q9Z2H6 Q4KL29
Position
6 F2; 6 58.33 cM
AA seq 219 aa
MWLEESQMKSKGTRHPQLIPCVFAVVSISFLSACFISTCLVTHHYFLRWTRGSVVKLSDY
HTRVTCIREEPQPGATGGTWTCCPVSWRAFQSNCYFPLNDNQTWHESERNCSGMSSHLVT
INTEAEQNFVTQLLDKRFSYFLGLADENVEGQWQWVDKTPFNPHTVFWEKGESNDFMEED
CVVLVHVHEKWVWNDFPCHFEVRRICKLPGITFNWKPSK
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtggctggaagaatcccaaatgaaatcaaaaggtacccgacatccccaactgatccct
tgcgtcttcgctgttgtttccatctcgttccttagtgcttgctttatttcaacttgtttg
gtgactcatcattactttttacgctggacgagaggaagtgtggtgaaactgtcagactac
cacacgagagtaacgtgcatccgagaggagccacagcctggagctacaggaggtacttgg
acctgctgtcctgttagctggagagccttccagtctaactgttactttcctcttaatgac
aaccagacctggcatgagagcgagaggaactgctcagggatgagcagtcatctggtgacc
atcaacaccgaagcagaacagaattttgtgacccagcttttggataaacggttttcttat
ttcctgggacttgctgatgagaatgtggaaggccaatggcagtgggtggacaagacgcca
tttaacccacacacggtattctgggaaaagggggaatccaatgactttatggaagaagac
tgtgttgtccttgttcatgtccatgaaaaatgggtctggaatgactttccttgtcacttt
gaggtgagaaggatttgtaaattacctggaataacattcaattggaagccctcgaagtga

DBGET integrated database retrieval system