KEGG   Mus musculus (mouse): 17523
Entry
17523             CDS       T01002                                 

Gene name
Mpo, mKIAA4033
Definition
(RefSeq) myeloperoxidase
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00983  Drug metabolism - other enzymes
mmu04145  Phagosome
mmu04613  Neutrophil extracellular trap formation
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    17523 (Mpo)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17523 (Mpo)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    17523 (Mpo)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    17523 (Mpo)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    17523 (Mpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    17523 (Mpo)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     17523 (Mpo)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   17523 (Mpo)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 17523
NCBI-ProteinID: NP_034954
MGI: 97137
Ensembl: ENSMUSG00000009350
Vega: OTTMUSG00000001441
UniProt: P11247 Q7TMS4 Q571G0
Position
11 52.22 cM; 11 C
AA seq 718 aa
MKLLLALAGLLAPLAMLQTSNGATPALLGEVENSVVLSCMEEAKQLVDRAYKERRESIKR
SLQSGSASPTELLFYFKQPVAGTRTAVRAADYLHVALDLLKRKLQPLWPRPFNVTDVLTP
AQLNLLSVSSGCAYQDVRVTCPPNDKYRTITGHCNNRRSPTLGASNRAFVRWLPAEYEDG
VSMPFGWTPGVNRNGFKVPLARQVSNAIVRFPNDQLTKDQERALMFMQWGQFLDHDITLT
PEPATRFSFFTGLNCETSCLQQPPCFPLKIPPNDPRIKNQKDCIPFFRSCPACTRNNITI
RNQINALTSFVDASGVYGSEDPLARKLRNLTNQLGLLAINTRFQDNGRALMPFDSLHDDP
CLLTNRSARIPCFLAGDMRSSEMPELTSMHTLFVREHNRLATQLKRLNPRWNGEKLYQEA
RKIVGAMVQIITYRDYLPLVLGPAAMKKYLPQYRSYNDSVDPRIANVFTNAFRYGHTLIQ
PFMFRLNNQYRPTGPNPRVPLSKVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIVVD
EIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLEL
ARKLMAQYGTPNNIDIWMGGVSEPLEPNGRVGQLLACLIGTQFRKLRDGDRFWWENPGVF
SKQQRQALASISLPRIICDNTGITTVSKNNIFMSNTYPRDFVSCNTLPKLNLTSWKET
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgaagctactcttggccttggcaggcctcctggcccctctggccatgcttcagacctcc
aatggtgccaccccagctctcctgggggaagtggagaattcagttgtgctgagctgtatg
gaagaggccaagcagctagtggacagagcctacaaggagcggagagaaagcatcaagcgg
agcctccaaagcggctctgccagccccacggagctcctgttttacttcaagcagccggtg
gcgggcaccagaacagctgtgagggccgctgattatctacatgtggccctagacctgctg
aagaggaagctgcagcccctgtggccaaggcctttcaatgttacagatgtgttgacacct
gctcagctgaatctgttgtccgtgtcaagtggctgtgcctatcaggacgtgagggtgaca
tgcccaccgaatgacaagtatcgcaccatcactggacactgcaacaacagacgaagcccc
actctgggggcctccaaccgtgcctttgtacgctggttgcctgcagagtatgaagatggc
gtctccatgccctttggctggacgcctggagtcaatcgcaatggcttcaaggtgcccctg
gctcgccaggtctccaatgccatcgtgcgcttccccaacgatcagctgaccaaggaccag
gagcgtgcactcatgttcatgcagtggggacagtttctggatcatgatatcaccttgact
ccagagccagctacccggttctccttcttcactggcctcaactgcgagaccagctgcctg
cagcagccaccctgcttccccctcaagatcccacccaatgaccctcgaatcaagaaccaa
aaggactgcatccccttcttccgctcctgcccggcatgcaccaggaacaacatcaccatt
cgcaaccagatcaacgcgctcacttccttcgtggacgccagcggggtgtacggcagcgag
gaccccctagccagaaagctgcgcaacctcaccaaccagctggggctgctggctatcaat
acacgcttccaagacaatggcagggccctgatgccctttgacagcctgcacgatgacccc
tgcctcctcaccaaccgctccgcccgcattccttgttttctggcaggggacatgcgctcc
agcgagatgccggagctcacctccatgcacaccctctttgttcgagagcataaccggctg
gccacacagctcaagcgcctgaatcctcgatggaatggggagaagctctaccaggaggcc
cggaagattgtaggggccatggtccagatcatcacataccgggactacctgcccttggtg
ttggggccagcagccatgaagaagtacctaccccagtaccgatcttacaacgactcagta
gaccctcgaatcgccaatgtcttcaccaacgctttccgttatggccacaccctcatccaa
cccttcatgttccgcctgaacaatcagtaccggcccacagggcccaacccccgagtccca
ctcagcaaggtcttttttgccagctggagagtcgtgttggaaggtggcattgaccccatc
ctccgaggcctcatggccactccagccaaactgaatcgccagaatcaaattgtggtggat
gagatccgggagcgactatttgagcaagtcatgaggataggactggatttgcctgctctt
aacatgcagcgcagccgggatcacggcctcccaggatacaatgcctggagacgcttttgt
gggcttccacagcccagcacagtgggtgagctcggcacggtgctgaagaacctggagttg
gcacggaagctgatggcacaatatggcacgcccaacaacattgacatctggatgggcggt
gtgtccgagcccctggagcccaatggccgtgtaggccagctccttgcctgcctcattggc
actcagtttaggaagctacgtgatggtgatcggttttggtgggagaacccaggcgtgttc
agtaaacagcagagacaggccttggccagcatctccttgccccgtatcatctgtgacaac
actggcatcaccaccgtgtcgaagaacaacatcttcatgtccaacacatacccccgagac
tttgtcagctgtaacacccttcctaaactgaacctgacttcctggaaggagacctag

DBGET integrated database retrieval system