KEGG   Mus musculus (mouse): 17523Help
Entry
17523             CDS       T01002                                 

Gene name
Mpo, mKIAA4033
Definition
(RefSeq) myeloperoxidase
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00983  Drug metabolism - other enzymes
mmu04145  Phagosome
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    17523 (Mpo)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17523 (Mpo)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    17523 (Mpo)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    17523 (Mpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    17523 (Mpo)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     17523 (Mpo)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   17523 (Mpo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 17523
NCBI-ProteinID: NP_034954
MGI: 97137
Ensembl: ENSMUSG00000009350
Vega: OTTMUSG00000001441
UniProt: P11247 Q7TMS4 Q571G0
Position
11 52.22 cM; 11 C
AA seq 718 aa AA seqDB search
MKLLLALAGLLAPLAMLQTSNGATPALLGEVENSVVLSCMEEAKQLVDRAYKERRESIKR
SLQSGSASPTELLFYFKQPVAGTRTAVRAADYLHVALDLLKRKLQPLWPRPFNVTDVLTP
AQLNLLSVSSGCAYQDVRVTCPPNDKYRTITGHCNNRRSPTLGASNRAFVRWLPAEYEDG
VSMPFGWTPGVNRNGFKVPLARQVSNAIVRFPNDQLTKDQERALMFMQWGQFLDHDITLT
PEPATRFSFFTGLNCETSCLQQPPCFPLKIPPNDPRIKNQKDCIPFFRSCPACTRNNITI
RNQINALTSFVDASGVYGSEDPLARKLRNLTNQLGLLAINTRFQDNGRALMPFDSLHDDP
CLLTNRSARIPCFLAGDMRSSEMPELTSMHTLFVREHNRLATQLKRLNPRWNGEKLYQEA
RKIVGAMVQIITYRDYLPLVLGPAAMKKYLPQYRSYNDSVDPRIANVFTNAFRYGHTLIQ
PFMFRLNNQYRPTGPNPRVPLSKVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIVVD
EIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLEL
ARKLMAQYGTPNNIDIWMGGVSEPLEPNGRVGQLLACLIGTQFRKLRDGDRFWWENPGVF
SKQQRQALASISLPRIICDNTGITTVSKNNIFMSNTYPRDFVSCNTLPKLNLTSWKET
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgaagctactcttggccttggcaggcctcctggcccctctggccatgcttcagacctcc
aatggtgccaccccagctctcctgggggaagtggagaattcagttgtgctgagctgtatg
gaagaggccaagcagctagtggacagagcctacaaggagcggagagaaagcatcaagcgg
agcctccaaagcggctctgccagccccacggagctcctgttttacttcaagcagccggtg
gcgggcaccagaacagctgtgagggccgctgattatctacatgtggccctagacctgctg
aagaggaagctgcagcccctgtggccaaggcctttcaatgttacagatgtgttgacacct
gctcagctgaatctgttgtccgtgtcaagtggctgtgcctatcaggacgtgagggtgaca
tgcccaccgaatgacaagtatcgcaccatcactggacactgcaacaacagacgaagcccc
actctgggggcctccaaccgtgcctttgtacgctggttgcctgcagagtatgaagatggc
gtctccatgccctttggctggacgcctggagtcaatcgcaatggcttcaaggtgcccctg
gctcgccaggtctccaatgccatcgtgcgcttccccaacgatcagctgaccaaggaccag
gagcgtgcactcatgttcatgcagtggggacagtttctggatcatgatatcaccttgact
ccagagccagctacccggttctccttcttcactggcctcaactgcgagaccagctgcctg
cagcagccaccctgcttccccctcaagatcccacccaatgaccctcgaatcaagaaccaa
aaggactgcatccccttcttccgctcctgcccggcatgcaccaggaacaacatcaccatt
cgcaaccagatcaacgcgctcacttccttcgtggacgccagcggggtgtacggcagcgag
gaccccctagccagaaagctgcgcaacctcaccaaccagctggggctgctggctatcaat
acacgcttccaagacaatggcagggccctgatgccctttgacagcctgcacgatgacccc
tgcctcctcaccaaccgctccgcccgcattccttgttttctggcaggggacatgcgctcc
agcgagatgccggagctcacctccatgcacaccctctttgttcgagagcataaccggctg
gccacacagctcaagcgcctgaatcctcgatggaatggggagaagctctaccaggaggcc
cggaagattgtaggggccatggtccagatcatcacataccgggactacctgcccttggtg
ttggggccagcagccatgaagaagtacctaccccagtaccgatcttacaacgactcagta
gaccctcgaatcgccaatgtcttcaccaacgctttccgttatggccacaccctcatccaa
cccttcatgttccgcctgaacaatcagtaccggcccacagggcccaacccccgagtccca
ctcagcaaggtcttttttgccagctggagagtcgtgttggaaggtggcattgaccccatc
ctccgaggcctcatggccactccagccaaactgaatcgccagaatcaaattgtggtggat
gagatccgggagcgactatttgagcaagtcatgaggataggactggatttgcctgctctt
aacatgcagcgcagccgggatcacggcctcccaggatacaatgcctggagacgcttttgt
gggcttccacagcccagcacagtgggtgagctcggcacggtgctgaagaacctggagttg
gcacggaagctgatggcacaatatggcacgcccaacaacattgacatctggatgggcggt
gtgtccgagcccctggagcccaatggccgtgtaggccagctccttgcctgcctcattggc
actcagtttaggaagctacgtgatggtgatcggttttggtgggagaacccaggcgtgttc
agtaaacagcagagacaggccttggccagcatctccttgccccgtatcatctgtgacaac
actggcatcaccaccgtgtcgaagaacaacatcttcatgtccaacacatacccccgagac
tttgtcagctgtaacacccttcctaaactgaacctgacttcctggaaggagacctag

DBGET integrated database retrieval system