KEGG   Mus musculus (mouse): 17527
Entry
17527             CDS       T01002                                 

Gene name
Mpv17, Tg.Mpv, Tg.Mpv17
Definition
(RefSeq) MpV17 mitochondrial inner membrane protein
  KO
K13348  protein Mpv17
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    17527 (Mpv17)
SSDB
Motif
Pfam: Mpv17_PMP22 Romo1
Other DBs
NCBI-GeneID: 17527
NCBI-ProteinID: NP_001281253
MGI: 97138
Ensembl: ENSMUSG00000107283
Vega: OTTMUSG00000022466
UniProt: P19258
Position
5; 5 B1
AA seq 176 aa
MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQAGRTLTMVSLGCG
FVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQDNW
AKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKAHQF
NT seq 531 nt   +upstreamnt  +downstreamnt
atggcactctggcgagcataccagagagccctggcagcacatccgtggaaagtccaggtt
ctgacagctggatcactgatgggcgtaggtgacatgatctcacagcagctggtggagagg
cggggtctccagcaacaccaggcaggccgcactctgaccatggtatccctgggctgtggc
tttgtgggccctgtcgtcggaggctggtacaaagttttagaccacttaatcccgggcacc
acgaaggtgcatgcactgaagaagatgttgttagatcaggggggctttgccccatgtttc
ctaggctgctttctcccactggtcgggatactcaatggaatgtcagcccaggacaattgg
gccaaactgaagcgggactaccctgatgccctcatcaccaactactatctctggcctgct
gtgcagttagccaacttctacctggtccccctgcattacaggttggctgttgtccagtgt
gttgctattgtctggaactcctacctatcctggaaggcacatcagttctaa

KEGG   Mus musculus (mouse): 234384
Entry
234384            CDS       T01002                                 

Gene name
Mpv17l2, Fksg2, Fksg24
Definition
(RefSeq) MPV17 mitochondrial membrane protein-like 2
  KO
K13348  protein Mpv17
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    234384 (Mpv17l2)
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 234384
NCBI-ProteinID: NP_898993
MGI: 2681846
Ensembl: ENSMUSG00000035559
Vega: OTTMUSG00000061544
UniProt: Q8VIK2
Position
8; 8 B3.3
AA seq 200 aa
MALGGWRWARKALAAGRPLFQGRALLLTNTLGCGVLMAAGDGARQVWEVRARPGQRFSAR
RSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLG
LGSLEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDT
YLSYLKYWVPEPLQTPGCAD
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctctgggaggctggcgctgggctcgcaaggcgttggctgcggggcgcccgctgttc
cagggccgcgcgctgctcctcaccaacacactgggctgcggcgtgctcatggccgcgggc
gatggcgcgcgacaggtctgggaagtgcgcgcgcggcctggacagagattcagcgcgcgg
cgctcagccagcatgttcgccgtgggctgcagcatgggccccttcctacacttctggtat
ctgtggttggaccgcctcctccccgcgtcgggcctacgaagcctcccgagtgtgatgaag
aaggtgctagtggatcaaacggtggcatctcccattctgggcgtctggtacttcctgggc
cttggcagcctggagggtcagacactagaggagagctgccaggagctgcgggccaaattc
tgggacttctacaaggccgactggtgtgtgtggccagctgcccagctagtgaacttcctc
ttcatcccttctcatttccgagtcacctatatcaatgggctgacactgggctgggacaca
tacctgtcctatctgaagtactgggtccctgaaccccttcagactccgggctgtgcagac
tga

KEGG   Mus musculus (mouse): 93734
Entry
93734             CDS       T01002                                 

Gene name
Mpv17l, M-, M-LP
Definition
(RefSeq) Mpv17 transgene, kidney disease mutant-like
  KO
K13349  Mpv17-like protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    93734 (Mpv17l)
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 93734
NCBI-ProteinID: NP_291042
MGI: 2135951
Ensembl: ENSMUSG00000022679
Vega: OTTMUSG00000028136
UniProt: Q99MS3
Position
16; 16 A1
AA seq 194 aa
MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPADWRQTRRVATLAVTFHG
NFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGKDDIFLDLKQ
KFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAYTGLCAFLWATFLCFSQQSGDGTLQSIFI
FLRRKEASDKSPEK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcgagctggtggcgcgcgtttccacaggcagcacggcgctatccgtggcccactaac
gtgctgctctacgccgggctcttctcggcgggtgatgccctgcagcagcgactgcgggga
ggcccagccgactggcgccagacgcgtcgcgtggccactctggccgtgaccttccacgga
aacttcaactacgtgtggctgcgcctactggagcgcgccctgccaggccgcgcgccgcgc
acggtcctggccaaggtgctatgcgatcagactgtcggagggccgatagccctctctgcc
ttctacgtcggcatgagcgttctccaggggaaggatgacatatttttggacctgaagcag
aaattctggaatacgtataagagtggtctcatgtactggccctttgtgcagctgaccaac
ttcagccttgtccctgtgcactggaggacagcatatacgggactctgtgcctttctctgg
gccaccttcctatgcttttcacagcagagcggcgatggtacactgcagtccatattcatc
ttccttcgcaggaaggaggcgagtgataagtccccagagaagtga

DBGET integrated database retrieval system