KEGG   Mus musculus (mouse): 17534
Entry
17534             CDS       T01002                                 

Symbol
Mrc2, Endo180, mKIAA0709, uPARAP
Name
(RefSeq) mannose receptor, C type 2
  KO
K06560  mannose receptor, C type
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17534 (Mrc2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    17534 (Mrc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17534 (Mrc2)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    17534 (Mrc2)
   04090 CD molecules [BR:mmu04090]
    17534 (Mrc2)
   04091 Lectins [BR:mmu04091]
    17534 (Mrc2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    17534 (Mrc2)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   17534 (Mrc2)
CD molecules [BR:mmu04090]
 Proteins
  17534 (Mrc2)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 6: Mannose receptor family
   17534 (Mrc2)
SSDB
Motif
Pfam: Lectin_C fn2 UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 17534
NCBI-ProteinID: NP_032652
MGI: 107818
Ensembl: ENSMUSG00000020695
Vega: OTTMUSG00000002846
UniProt: Q64449 Q14AX9
Position
11; 11 E1
AA seq 1479 aa
MVPIRPALAPWPRHLLRCVLLLGGLRLGHPADSAAALLEPDVFLIFSQGMQGCLEAQGVQ
VRVTPVCNASLPAQRWKWVSRNRLFNLGATQCLGTGWPVTNTTVSLGMYECDREALSLRW
QCRTLGDQLSLLLGARASNASKPGTLERGDQTRSGHWNIYGSEEDLCARPYYEVYTIQGN
SHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDK
DQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGLN
DLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKK
KPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIH
SMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDC
VTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVI
YSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEV
IYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDP
TPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEH
FVAHMLNKIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDD
IRGCAVLDLASLQWVPMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFE
HHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLHTLESDGRFR
WTDGSIINFISWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETQP
QDLPPSALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQA
FITASLPNVTFDLWIGLHASQRDFQWIEQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVI
LHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGAELSYLNHTFRLLQ
KPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQTPLWIGLASEEGSRRYSWLSE
EPLNYVSWQDEEPQHSGGCAYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPRRINYRGSCP
QGLADSSWIPFREHCYSFHMEVLLGHKEALQRCQKAGGTVLSILDEMENVFVWEHLQTAE
AQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPG
ACTNITMGVVCKLPRVEENSFLPSAALPESPVALVVVLTAVLLLLALMTAALILYRRRQS
AERGSFEGARYSRSSHSGPAEATEKNILVSDMEMNEQQE
NT seq 4440 nt   +upstreamnt  +downstreamnt
atggtacccatccgacctgccctcgcgccctggcctcgtcacctgctgcgctgcgtcttg
cttctcgggggactgcgtctcggccacccggcggactccgccgccgccctcctggagcct
gatgtcttcctcatcttcagccaggggatgcagggctgtctggaggcccagggtgtgcag
gtccgagtcaccccagtctgcaatgccagtctccctgcccagcgctggaagtgggtctcc
cggaaccgactcttcaacctgggtgccacacagtgcctgggtacaggctggccagtcacc
aacaccacagtttccttgggcatgtatgagtgtgacagagaggccttgagtcttcgatgg
cagtgtcgtacactaggggaccagttgtccctgcttctgggggctcgtgcaagcaatgca
tccaagcctggcaccctggagcgcggtgaccagacccgcagtggccattggaacatctat
ggcagtgaagaagacctatgtgctcgaccttactatgaggtctacaccatccagggaaac
tcacacggaaagccgtgcactatccccttcaaatacgacaaccagtggttccacggctgc
accagcactggcagagaagatgggcacctgtggtgtgccaccacccaggactacggcaaa
gatgagcgctggggcttctgccccatcaagagtaacgactgtgagaccttctgggacaaa
gaccagctgactgacagctgttaccagtttaacttccaatccacactgtcctggagggag
gcctgggccagctgcgagcagcagggtgcagacttgctgagtatcacggagatccacgag
cagacctacatcaacgggctcctcacgggctacagctccacgctatggattggccttaat
gacctggataccagtggaggctggcagtggtcagacaactcacccctcaagtacctcaac
tgggagagtgatcagccggacaacccaggtgaggagaactgtggagtgatccggactgag
tcctcaggcggctggcagaaccatgactgcagcatcgccctgccctatgtttgcaagaag
aaacccaacgctacggtcgagcccatccagccagaccggtggaccaatgtcaaggtggaa
tgtgaccccagctggcagcccttccagggccactgctaccgcctgcaggccgagaagcgc
agctggcaggagtccaagagggcgtgtctgcggggtgggggtgacctccttagcatccac
agcatggctgagctggagttcatcaccaaacagatcaagcaagaggtggaggagctatgg
attggcctcaatgatttgaaactgcagatgaattttgagtggtccgacgggagcctcgtg
agcttcacccactggcacccctttgagcccaacaactttcgtgacagcctggaggactgt
gtcaccatctgggggccggaaggacgctggaacgacagtccctgtaaccagtccttgcca
tccatttgcaagaaggcaggccggctgagccagggcgctgcggaggaggaccacggctgc
cggaagggttggacgtggcatagcccatcctgctactggctgggagaggaccaagtgatc
tacagtgatgcccggcgcctgtgtactgaccatggctctcagctggtcaccatcaccaac
aggtttgagcaggccttcgtcagcagcctcatctataactgggagggcgaatacttctgg
acagccctgcaagacctcaacagtactggctccttccgttggctcagtggggatgaagtc
atatatacccattggaatcgagaccagcctgggtacagacgtggaggctgtgtggctctg
gccactggcagtgccatgggactgtgggaggtgaagaactgcacatcgttccgggctcgc
tacatctgccgacagagcctgggcacaccggtcacaccagagctgcctgggccagacccc
acgcccagcctcactggctcctgtccccagggctgggtctcagaccccaaactccgacac
tgctataaggtgttcagctcagagcggctgcaggagaagaagagttggatccaggccctg
ggggtctgccgggagttgggggcccagctgctgagtctggccagctatgaggaggagcac
tttgtggcccacatgctcaacaagatctttggtgagtcagagcctgagagccatgagcag
cactggttttggattggcctgaaccgcagagaccctagagagggtcacagctggcgctgg
agcgacggtctagggttttcctaccacaattttgcccggagccgacatgatgacgatgat
atccgaggctgtgcagtgctggacctggcctccctgcagtgggtacccatgcagtgccag
acgcagcttgactggatctgcaagatccctagaggtgtggatgtgcgggaaccagacatt
ggtcgacaaggccgtctggagtgggtacgctttcaggaggccgagtacaagttttttgag
caccactcctcgtgggcgcaggcacagcgcatctgcacctggttccaggcagatctgacc
tccgttcacagccaagcagaactggacttcctggggcaaaacctgcagaagctgtcctca
gaccaggagcagcactggtggatcggcctgcacaccttggagagtgacggacgcttcagg
tggacagatggttctattataaacttcatctcttgggcaccgggaaaacctagacccatt
ggcaaggacaagaagtgtgtatacatgacagccagacaagaggactggggggaccagagg
tgccatacggctttgccctacatctgtaagcgcagcaatagctctggagagactcagccc
caagacttgccaccttcagccttaggaggctgcccctccggttggaaccagttcctcaat
aagtgtttccgaatccagggccaggacccccaggacagggtgaaatggtcagaggcacag
ttctcctgtgaacagcaagaagcccagctggtcaccattgcaaaccccttagagcaagca
tttatcacagccagcctccccaacgtgacctttgacctttggattggcctgcatgcctct
cagagggacttccagtggattgaacaagaacccctgctctataccaactgggcaccagga
gagccctctggccccagccctgctcccagtggcaccaagccgaccagctgtgcggtgatc
ctgcacagcccctcagcccacttcactggccgctgggatgatcggagctgcacagaggag
acgcatggcttcatctgccagaagggcacagacccctcgctaagcccatccccagcagca
acaccccctgccccgggcgctgagctctcctatctcaaccacaccttccggctgctgcag
aagccactgcgctggaaagatgctctcctgctgtgtgagagccgaaatgccagcctggca
cacgtgcccgatccctacacacaagccttcctcacacaggctgcacgggggctgcaaaca
ccactgtggatcgggctggccagtgaggagggctcacggaggtattcctggctctcagag
gagcctctgaattatgtgagctggcaagatgaggagccccagcactcgggaggctgtgcc
tacgtggatgtggatggaacctggcgcaccaccagctgtgataccaagctgcagggggca
gtgtgtggggtgagcagggggcccccaccccgaaggataaactaccgtggcagctgtcct
cagggcttggctgactcgtcctggattcccttcagggagcattgctattctttccacatg
gaggtgctgttgggccacaaggaggcgctgcagcgctgtcagaaagctggtgggacggtt
ctgtccattcttgatgagatggagaatgtgtttgtctgggagcacctgcagacagctgaa
gcccaaagtcgaggtgcctggttgggcatgaacttcaaccccaaaggaggcacgctggtc
tggcaagacaacacagctgtgaactattctaactgggggccccctggcctgggccctagc
atgctaagccacaacagctgctactggatccagagcagcagcggactgtggcgccccggg
gcttgtaccaacatcaccatgggagttgtctgcaagctccctagagtggaagagaacagc
ttcttgccatcagcagccctccccgagagcccggttgccctggtggtggtgctgacagcg
gtgctgctcctcctggccttgatgacggcagccctcatcctctaccggcgccgacagagt
gcggagcgtgggtccttcgagggggcccgctacagtcgcagcagccactctggccccgca
gaggccaccgagaagaacattctggtgtctgacatggaaatgaacgaacagcaagaatag

DBGET integrated database retrieval system