KEGG   Mus musculus (house mouse): 17535
Entry
17535             CDS       T01002                                 
Symbol
Mre11a, Mre11, Mre11b
Name
(RefSeq) MRE11A homolog A, double strand break repair nuclease
  KO
K10865  double-strand break repair protein MRE11
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03440  Homologous recombination
mmu03450  Non-homologous end-joining
mmu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    17535 (Mre11a)
   03450 Non-homologous end-joining
    17535 (Mre11a)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    17535 (Mre11a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    17535 (Mre11a)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17535 (Mre11a)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    17535 (Mre11a)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     17535 (Mre11a)
    BRCA1-C complex
     17535 (Mre11a)
   NHEJ (non-homologous end-joining)
    MRX complex
     17535 (Mre11a)
SSDB
Motif
Pfam: Mre11_DNA_bind Metallophos
Other DBs
NCBI-GeneID: 17535
NCBI-ProteinID: NP_061206
MGI: 1100512
Ensembl: ENSMUSG00000031928
UniProt: Q61216 Q3TU24 Q3URU4
Position
9:14695971..14748421
AA seq 706 aa
MSPTDPLDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGD
LFHENKPSRKTLHSCLELLRKYCMGDRPVQFEVISDQSVNFGFSKFPWVNYQDGNLNISI
PVFSIHGNHDDPTGADALCALDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYG
LGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGNTNFIPEQFLDDFIDL
VIWGHEHECKIGPIKNEQQLFYVSQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMQKLP
LRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLGNPQQPGK
PLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHREQKGKTGEEINFGMLITK
PASEGATLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLE
KTQRFLKERHIDALEDKIDEEVRRFRESRQRNTNEEDDEVREAMSRARALRSQSETSTSA
FSAEDLSFDTSEQTANDSDDSLSAVPSRGRGRGRGRRGARGQSSAPRGGSQRGRDTGLEI
TTRGRSSKATSSTSRNMSIIDAFRSTRQQPSRNVAPKNYSETIEVDDSDEDDIFPTNSRA
DQRWSGTTSSKRMSQSQTAKGVDFESDEDDDDDPFMSSSCPRRNRR
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgagccccacagatccacttgacgatgaagacacatttaaaatcctggttgccactgat
attcatcttggatttatggagaaagatgcagttagaggaaatgatacatttgtgacattt
gatgaaatcttaagacttgccctggaaaatgaagtggattttattttgttaggtggtgat
cttttccatgaaaacaagccctcgaggaaaaccctgcacagctgcttggagctgcttagg
aagtactgtatgggtgaccgccctgtgcagtttgaggtcatcagtgatcagtcagtcaac
tttggttttagtaagtttccatgggtgaactaccaggatggcaatctcaacatttccatt
ccagtatttagtatccacggcaaccatgatgatcccacgggggcagatgccctctgtgcc
ctggatgttttaagctgtgctgggtttgtgaatcactttggacggtcaatgtcggtggag
aaggttgacattagtccggttctgctgcagaaaggaagcacaaaactcgctctgtacggc
ttaggctccattccagatgaaaggctctatcggatgtttgtgaataaaaaagtaacaatg
ttgagaccaaaggaagatgagaactcatggtttaacttatttgtgattcatcagaacagg
agtaagcatggaaacaccaacttcattccagagcagtttttggatgacttcatcgacctc
gttatctggggccatgaacatgagtgtaaaattggcccaatcaaaaatgagcagcagctc
ttctatgtgtctcagcccggaagctcagtggtgacgtccctttcccctggagaagctgtg
aagaaacatgtaggcttgctgcgcattaaagggagaaagatgaacatgcagaagctgcct
ctccgcaccgtgcggcggttcttcatagaagacgtggttctggctaaccacccaaacctg
ttcaaccctgacaatcctaaggtgacccaggccatccagagcttctgtctggagaagatt
gaagaaatgcttgacagtgctgagcgggaacgactggggaatcctcagcagccggggaag
cctcttatccgactacgggtggactatagtggaggctttgaacctttcaacgttcttcgt
tttagccagaagtttgtggatcgagtcgctaacccaaaagatgtcatccactttttcagg
cacagggaacaaaagggaaaaacaggagaagagatcaactttgggatgctcatcacaaaa
cctgcttcagaaggagcaacgcttagagtagaagacctcgtaaagcagtatttccaaact
gcagagaagaatgttcagctctcgctgctgacagaaagagggatgggcgaagcagttcaa
gagtttgtggacaaggaagagaaagatgccatcgaggaattagtgaagtaccagctggag
aaaacacagcggtttcttaaggagcgccatattgatgctctggaagacaagattgatgag
gaggtccgacgtttccgagaaagcagacagagaaataccaacgaagaagatgatgaagtt
cgagaggccatgagcagagcccgggccctcagatcacagtcagagacctccacctcagcc
tttagtgctgaggacctgagctttgatacatcggagcagacagcaaatgactctgatgac
agcctgtcagcagtgccgagcagaggccgaggccgaggccgagggcgaagaggagccaga
gggcagagctcggcacctagaggaggctctcagagaggccgagacactgggctggagatc
actactcgaggcaggagctcaaaggccacctcatcaacatctagaaacatgtccattata
gacgctttcagatctacccgacaacagccttctagaaatgtagcccctaagaattactca
gagaccattgaggtggatgactctgacgaagatgacatttttcctaccaattccagggct
gatcaaaggtggtcgggcacaacatctagcaaacggatgtcccagagccagacagccaaa
ggggtagactttgaatcagatgaggatgatgacgatgaccctttcatgagcagtagttgc
ccaagaagaaaccgaagataa

DBGET integrated database retrieval system