KEGG   Mus musculus (mouse): 17536Help
Entry
17536             CDS       T01002                                 

Gene name
Meis2, A430109D20Rik, Mrg1, Stra10
Definition
(RefSeq) Meis homeobox 2
  KO
K16670  homeobox protein Meis2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17536 (Meis2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, MEIS
    17536 (Meis2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Meis_PKNOX_N Homeobox_KN Homeodomain
Motif
Other DBs
NCBI-GeneID: 17536
NCBI-ProteinID: NP_001153040
MGI: 108564
Ensembl: ENSMUSG00000027210
Vega: OTTMUSG00000015219
UniProt: P97367 Q3UJ35
Position
2 E4-E5; 2 58.28 cM
AA seq 477 aa AA seqDB search
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNV
MPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFN
EDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLK
GKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGH
ASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLT
HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYS
PEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMGMAQPSYTPPQMTPHPTQLR
HGPPMHSYLPSHPHHPAMVMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaggtacgatgagctgccccattacggcgggatggacggagtaggggttccc
gcttccatgtacggagaccctcacgcgccgcggccgatccccccggttcaccacctaaac
cacgggccgccgctccacgccacgcagcactacggcgcgcacgccccgcaccccaatgtc
atgccagccagcatgggatctgctgtcaacgacgccttgaaaagagacaaggacgcaatc
tatgggcacccgttgtttcctctgttagctctggtttttgagaagtgcgagctggcgacc
tgcactccccgggaacccggagtggccggcggagacgtctgttcctctgactccttcaac
gaggacatcgcggtcttcgccaagcaggttcgcgccgaaaagcctcttttttcctcaaac
ccagagctggataatttgatgatacaagcaattcaagtactaaggtttcatcttctggag
ttagaaaaggtccacgaactatgtgataacttctgccaccggtacattagctgtttgaag
ggaaaaatgcccattgacctcgtgattgatgagagagatggaagctccaagtcagatcat
gaagaactttcaggctcctccacaaatctcgccgaccacaacccttcatcctggcgagac
cacgatgacgcaacctcaacgcactccgcaggcaccccaggaccctccagtgggggccat
gcttcccagagtggagacaacagcagtgagcaaggcgatgggttagacaacagcgtagct
tcacctggcacaggtgatgacgacgatccagacaaggacaaaaaacgccagaagaaaaga
ggcatattccccaaagtcgcgacaaatatcatgagagcgtggctcttccagcatctcaca
cacccgtacccttcagaagaacagaagaaacagttagcgcaagacacgggactgacaatt
ctgcaagtgaacaactggtttatcaatgccagaagaagaatagtgcagcccatgattgac
cagtcaaatcgagcaggttttcttcttgatccttcagtgagccaaggagcagcgtatagt
ccagagggtcagcccatggggagctttgtgttggatggtcagcaacacatggggatccgg
cctgcaggtttgcagagcatgccaggggactacgtttctcagggtggtccaatgggaatg
ggtatggcccagccaagttacactcctccccagatgaccccacaccctactcagttaaga
catggacccccaatgcattcatatttgccaagccatccccaccacccagccatggtgatg
cacggaggaccccctacccaccctggaatgactatgtcagcacagagccccacaatgtta
aattctgtagatcccaatgttggcggacaggttatggacattcatgcccaatag

DBGET integrated database retrieval system