KEGG   Mus musculus (house mouse): 17686
Entry
17686             CDS       T01002                                 
Symbol
Msh3, D13Em1, REP-1, Rep-3, Rep3
Name
(RefSeq) mutS homolog 3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03430  Mismatch repair
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    17686 (Msh3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17686 (Msh3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17686 (Msh3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    17686 (Msh3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17686 (Msh3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     17686 (Msh3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV NPV_P10
Other DBs
NCBI-GeneID: 17686
NCBI-ProteinID: NP_034959
MGI: 109519
Ensembl: ENSMUSG00000014850
UniProt: P13705 A0A087WQ16
Position
13:complement(92348386..92491513)
AA seq 1095 aa
MPRGKSASGGSTAAGPGPGRQTVLSRFFRSAGSLRSSASSTEPAEKVTEGDSRKRSLGNG
GPTKKKARKVPEKEEENISVAAHHPEAKKCLRPRIVLKSLEKLKEFCCDSALPQNRVQTE
ALRERLEVLPRCTDFEDITLQRAKNAVLSEDSKSQANQKDSQFGPCPEVFQKTSDCKPFN
KRSKSVYTPLELQYLDMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMT
ASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNKSSVFSRKLTALYTKSTLIGE
DVNPLIRLDDSVNIDEVMTDTSTNYLLCIYEEKENIKDKKKGNLSVGIVGVQPATGEVVF
DCFQDSASRLELETRISSLQPVELLLPSDLSVPTEMLIQRATNVSVRDDRIRVERMNNTY
FEYSHAFQTVTEFYAREIVDSQGSQSLSGVINLEKPVICALAAVIRYLKEFNLEKMLSKP
ESFKQLSSGMEFMRINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKNWVTQ
PLLKLREINARLDAVSDVLHSESSVFEQIENLLRKLPDVERGLCSIYHKKCSTQEFFLIV
KSLCQLKSELQALMPAVNSHVQSDLLRALIVEAPELLSPVEHYLKVLNGPAAKVGDKTEL
FKDLSDFPLIKKRKNEIQEVIHSIQMRLQEFRKILKLPSLQYVTVSGQEFMIEIKNSAVS
CIPADWVKVGSTKAVSRFHPPFIVESYRRLNQLREQLVLDCNAEWLGFLENFGEHYHTLC
KAVDHLATVDCIFSLAKVAKQGNYCRPTLQEEKKIIIKNGRHPMIDVLLGEQDQFVPNST
SLSQDSERVMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGIVDGIFTRMGAA
DNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVK
SLTLFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSGDMEQMPDSVTFLYQITRG
IAARSYGLNVAKLADVPREVLQKAAHKSKELEGLVSLRRKRLECFTDLWTTHSVKDLHTW
ADKLEMEEIQTSLPH
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgccccgcgggaaatccgcgtcgggaggctctactgccgccggcccaggcccggggagg
caaacggttctaagccggttcttcaggtctgcgggaagcctaagatccagcgcgtcctcc
acggagccagcagagaaggtgacagaaggtgacagcaggaagaggtcactgggaaatggt
gggcccactaagaaaaaagcaaggaaagttccagagaaggaggaagaaaacatctcagta
gcagctcaccaccctgaggcaaagaaatgtctgaggcccaggattgttttaaagtccctg
gaaaagttgaaagaattctgctgtgattctgccctccctcaaaacagagtccagacagaa
gctcttcgggagagacttgaagttctgccaaggtgtactgattttgaagatatcactctg
caacgtgcaaagaatgcggttttgtccgaagattccaaatctcaggctaatcagaaagac
agtcaatttggaccctgccctgaagttttccagaagacttccgattgtaaaccttttaac
aagcgatccaagagcgtctatacaccgttagaactgcagtacttagatatgaagcagcag
cataaagacgcagttttgtgtgtggagtgtggttacaagtacagattctttggggaagat
gcagaaattgctgcccgggaactcaatatttattgccacttagaccacaactttatgact
gcaagcatacctacccacagactgttcgtgcatgtccgccgacttgtggccaaagggtac
aaggtgggagttgtgaagcaaactgaaactgccgcattaaaggccatcggagacaataaa
agttctgtcttctcccggaaattgaccgctctttatacgaaatccacacttattggtgaa
gatgtgaatcctctcatcaggctggatgattctgtaaatatcgatgaggtaatgacagat
acatctaccaactatcttctgtgtatctacgaagaaaaggagaacattaaagacaaaaag
aaggggaacctttccgttggtatcgtgggagtgcagcccgcaactggcgaggttgtgttt
gactgcttccaggactctgcttccagactggagctggagactcgcatatcaagcctgcag
cctgtggaattactgcttccctccgacctgtctgtgccaacagagatgctcatccaaaga
gccaccaatgtcagtgtgcgggatgacaggattcgagtagaaaggatgaataatacttac
tttgaatacagccatgctttccagacagttacggagttttatgctagagagatagttgac
agccagggctctcagagtctctctggtgtcattaacttggagaagcctgtgatctgcgcc
ttggctgccgtaataaggtacctcaaggaatttaacctggaaaagatgctgtccaaaccc
gagagttttaaacagctgtcaagtggaatggaattcatgagaattaatgggaccacgcta
aggaatctggagatccttcagaatcagactgatatgaagaccaaaggaagcttgctttgg
gttttagaccacactaaaacttcatttgggagaaggaagttaaagaattgggttacccag
ccactgcttaaattaagggaaataaatgcccgacttgatgcagtatctgatgttctccac
tcagaatccagtgtgtttgagcagatagaaaaccttcttcgtaagttaccggatgtcgag
agaggactatgtagcatttatcacaagaagtgctctacccaagagttcttcttgatcgtc
aaaagcctatgtcaactgaagtcagagcttcaagcattaatgcctgctgttaattcccac
gttcagtccgacttactccgagcactcatcgtggaggctcctgagctcctcagcccagtg
gaacattacttaaaggttctgaatgggccagctgccaaagttggcgataaaactgaatta
ttcaaagacctctctgacttccctttaataaaaaagaggaaaaatgaaattcaggaagtc
attcacagcatccaaatgcgtttacaggaatttcggaaaatattaaaacttccttcttta
cagtatgtgactgtatcaggacaagagtttatgattgaaataaagaactcggctgtatct
tgcatcccagctgattgggtgaaggttggaagcacaaaagctgtgagccgctttcaccct
cccttcatcgtggaaagctacagacgtctgaatcagctccgggagcagctagtccttgac
tgcaatgctgaatggcttggcttcctagagaattttggtgaacattatcacactttgtgt
aaggctgtggatcacctagcaactgttgactgtattttctccctggccaaggtcgctaaa
caaggaaattactgcaggccaactctacaagaagaaaagaagatcatcataaaaaatgga
aggcaccctatgattgatgtgttgctgggtgaacaagatcagtttgtgcccaacagtacg
agtttatcacaggactcggagagagtaatgataatcaccggaccaaacatgggtgggaaa
agctcctacataaaacaggttgcactggttaccatcatggctcagattggctcctacgtc
cctgcagaggaagccacaattgggattgtggatggcattttcacaaggatgggtgctgca
gacaatatatacaaaggccggagtactttcatggaagaactgacggacacagcggaaata
atcaggagagcgtccccacagtccttggttatcctggatgagctggggagagggacaagc
acccatgacggaatcgccatcgcctatgcaactctagagtattttatcagagacgtgaaa
tccttaacactgttcgttacccactatccaccagtctgtgaactagaaaaatgttaccca
gaacaagtggggaattaccacatgggattcttggtcaatgaagatgaaagcaagcaggac
tcaggtgacatggagcagatgccggattctgtcacttttctctatcagataacccgagga
attgcagcgagaagttatggacttaatgtggcgaagttagcagatgtacctagagaagtc
ttacagaaagccgcgcacaagtctaaggagctggaaggcttagtcagcctgagaaggaaa
aggcttgaatgttttaccgacttatggacgacacacagtgtgaaggacctgcacacatgg
gcagataagctggaaatggaggaaatacagacttctctcccacattaa

DBGET integrated database retrieval system