KEGG   Mus musculus (mouse): 17687
Entry
17687             CDS       T01002                                 

Gene name
Msh5, Mut5
Definition
(RefSeq) mutS homolog 5
  KO
K08741  DNA mismatch repair protein MSH5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17687 (Msh5)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutS homologs specialized for meiosis
     17687 (Msh5)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_IV
Other DBs
NCBI-GeneID: 17687
NCBI-ProteinID: NP_001139687
MGI: 1329021
Ensembl: ENSMUSG00000007035
Vega: OTTMUSG00000037144
UniProt: Q9QUM7 A0A0R4IZY8
Position
17 B1; 17 18.57 cM
AA seq 833 aa
MAFRATPGRTPPGPGPRSGIPSASFPSPQPPMAGPGGIEEEDEEEPAEIHLCVLWSSGYL
GIAYYDTSDSTIHFMPDAPDHESLKLLQRVLDEINPQSVVTSAKQDEAMTRFLGKLASEE
HREPKGPEIILLPSVDFGPEISKQRLLSGNYSFISDSMTATEKILFLSSIIPFDCVLTVR
ALGGLLKFLSRRRIGVELEDYDVGVPILGFKKFVLTHLVSIDQDTYSVLQIFKSESHPSV
YKVASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTRELRELNSRLDVIQFFLMPQNLD
MAQMLHRLLSHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFQ
DIAQEFSDDLHHIASLIGKVVDFEESLAENRFTVLPNIDPDIDAKKRRLIGLPSFLTEVA
QKELENLDSRIPSCSVIYIPLIGFLLSIPRLPFMVEASDFEIEGLDFMFLSEDKLHYRSA
RTKELDTLLGDLHCEIRDQETLLMYQLQCQVLARASVLTRVLDLASRLDVLLALASAARD
YGYSRPHYSPCIHGVRIRNGRHPLMELCARTFVPNSTDCGGDQGRVKVITGPNSSGKSIY
LKQVGLITFMALVGSFVPAEEAEIGVIDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNN
ATEHSLVLIDEFGKGTNSVDGLALLAAVLRHWLALGPSCPHVFVATNFLSLVQLQLLPQG
PLVQYLTMETCEDGEDLVFFYQLCQGVASASHASHTAAQAGLPDPLIARGKEVSDLIRSG
KPIKATNELLRRNQMENCQALVDTFLKLDLEDPTLDLDIFISQEVLPAAPTIL
NT seq 2502 nt   +upstreamnt  +downstreamnt
atggctttcagagcgaccccaggccggacgccgccgggacccggacccagatccggaatc
ccctcagccagcttccccagccctcagcccccaatggcggggcctggaggtatcgaggaa
gaggacgaggaggagcccgccgagatccatctgtgcgtgctgtggagctcgggatacctg
ggcattgcttactatgacactagtgactccactatccacttcatgccagatgccccagac
cacgagagcctaaagcttctccagagagttctggatgaaatcaacccccagtctgttgtc
acaagtgccaaacaggatgaggctatgactcgatttctagggaagcttgcctccgaggag
cacagagagccaaagggacctgaaatcatacttctgccaagcgtggattttggtccagag
ataagcaaacagcgtctcctttccggaaactactccttcatctcagactccatgactgct
actgagaaaatccttttcctctcctccattattccctttgactgtgtcctcacggtccgg
gcacttggaggactgctcaagttcctgagtcgaagaagaattggggttgaactggaagac
tatgatgttggcgtccctatcctgggattcaagaagtttgtattgacccatctggtgagc
atagatcaagacacttacagcgttctacagattttcaagagtgagtctcacccctcggtg
tacaaagtagccagtgggctgaaggaggggctcagcctttttggaatcctcaacagatgc
cgctgtaagtggggacagaagctgctcaggctgtggtttacacgtccaacccgggagcta
agggaactcaattcccgactggatgtcattcagttcttcctgatgcctcagaacctggac
atggcccagatgctgcaccgactcctgagccacatcaagaatgtgcctctgattctgaaa
cgcatgaagttgtcccacaccaaggtcagtgactggcaggtcctctacaagactgtgtac
agtgctctcggcctgagggatgcctgccgttctctgccacagtccatccagctttttcag
gacattgcccaggagttctctgacgacctgcatcacattgccagcctcatcgggaaggtg
gtggactttgaggaaagtcttgctgaaaatcgcttcacagtcctccctaacatagaccct
gacatagatgccaagaagcgaaggctgatagggcttccgagcttcctcactgaagttgct
cagaaggagctggagaacctggactctcgcatcccctcatgcagtgtcatctacatccct
ctgattggcttccttctttccattccccgcttgcctttcatggtggaagctagtgacttt
gagattgaggggctggacttcatgtttctctcagaggacaagctgcactatcgtagcgcc
cggaccaaggagctggacacgctgctgggagacctgcactgcgagatccgggaccaggag
accctgttgatgtaccagctgcagtgccaggtgctggcacgggcttcggtcttgactcgg
gtattggaccttgcctcccgcctggacgtcctgttggctcttgccagtgctgcccgggac
tacggctattcgagaccgcattactctccctgtatccatggagtacgaatcaggaatggc
aggcatcctctgatggaactgtgtgcacgaaccttcgtgcccaactccacggactgtggt
ggggaccagggcagggtcaaagtcatcactgggcccaactcctcagggaaaagcatatat
ctcaagcaggtaggcttgatcactttcatggccctggtgggcagtttcgtgcctgcagag
gaggccgagattggggtaatcgacgccatcttcactcgaattcacagctgcgaatccatc
tccctcggcctctccaccttcatgattgatctcaaccaggtggcgaaagcagtgaacaat
gccacagagcactcgctggtcctgatcgatgaattcgggaaggggaccaactcggtggat
ggcctggcacttctggctgctgtgctccgtcactggctagcactgggacccagctgcccc
cacgtctttgtagccaccaacttcctgagccttgttcagctgcagctgctgccgcaagga
cccctggtgcagtatttgaccatggagacttgtgaggatggggaagaccttgtcttcttc
taccagctttgccaaggcgtcgccagtgccagccacgcctcccacacagcggcccaggct
gggcttcctgacccactcattgctcgtggcaaagaggtctcagacttgatccgcagtggg
aaacccatcaaggccacgaatgagcttctgaggaggaaccaaatggaaaactgccaggca
ctggtggatacgtttctaaaactggacttggaggatcccaccctggacctggacattttc
attagtcaggaagtgctgcccgctgctcccaccatcctctga

DBGET integrated database retrieval system