KEGG   Mus musculus (mouse): 17698
Entry
17698             CDS       T01002                                 

Gene name
Msn, C78546
Definition
(RefSeq) moesin
  KO
K05763  moesin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05162  Measles
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    17698 (Msn)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17698 (Msn)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17698 (Msn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    17698 (Msn)
  09172 Infectious disease: viral
   05162 Measles
    17698 (Msn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17698 (Msn)
   04147 Exosome [BR:mmu04147]
    17698 (Msn)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     17698 (Msn)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   17698 (Msn)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 17698
NCBI-ProteinID: NP_034963
MGI: 97167
Ensembl: ENSMUSG00000031207
Vega: OTTMUSG00000018161
UniProt: P26041
Structure
PDB: 
4YL8

Position
X; X C3
AA seq 577 aa
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKAFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERALLENEKKKRELAEKEKEKIEREKEELMEKLKQIEEQTKK
AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLASE
MAELTARISQLEMARKKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEH
DEQDENGAEASAELRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgccgaagacgatcagtgtgcgtgtcaccaccatggatgcagagctggagtttgccatt
cagcccaacaccactggcaagcagctgtttgaccaggtggtgaaaactattggtttgagg
gaagtttggttctttggtctgcagtaccaggacacaaaagctttctctacttggctgaaa
ctcaataagaaggtgactgcacaggatgtgcggaaggaaagtccattgctcttcaagttc
cgggccaagttctacccagaggatgtatctgaagaactgatccaggatatcacccagcgc
ctgttctttctgcaagtgaaggagggcattctcaatgacgacatttactgtccacctgaa
actgcggtcctgttggcttcttatgccgtccagtctaagtatggtgacttcaataaggaa
gtgcacaagtctggctacctggctggagataagttgcttccccaaagagtcttggagcag
cacaaactcaacaaggaccagtgggaagagaggatccaggtgtggcatgaggagcaccgg
ggcatgctcagggaggatgctgtcctggaatatctcaagattgctcaagacctggaaatg
tatggtgtgaactatttcagcatcaagaacaagaaaggctcagagctatggctgggcgtg
gatgccttgggtctcaacatctatgagcagaatgacagactgactcctaagattggcttc
ccgtggagtgaaatcaggaatatctctttcaatgataagaaatttgtcatcaagcccatt
gacaaaaaggccccggactttgtgttctatgctccccggcttcggattaacaagcggatc
ttggccctgtgcatgggaaatcatgagctgtacatgcgtcggcgcaagcctgacaccatt
gaggtgcagcagatgaaggcccaggctcgggaagagaagcaccagaagcagatggagcgt
gctctcctggaaaatgagaagaagaagcgtgagctggctgagaaagagaaggagaagatt
gagcgggagaaggaagagctgatggagaagctgaagcagattgaggagcagactaagaag
gctcagcaagagctggaagagcagacccgcagggccctagaacttgagcaggaacggaag
cgtgcccagagtgaggccgaaaagctagccaaggagcgtcaagaagctgaagaagccaaa
gaggccctgctgcaggcttctcgggaccagaagaagacccaggaacagctggcttcagaa
atggcagagctgacggcacggatctcccagttggaaatggctcgaaagaagaaggaaagt
gaggctgtggaatggcagcaaaaggcccagatggtacaggaagacttggagaagactcgt
gctgagctgaagactgccatgagtacacctcatgtggcagagcctgctgagaatgaacat
gatgagcaggatgagaatggagcagaggccagtgccgagctgcgggctgatgctatggcc
aaggaccgcagtgaggaggaacgtaccactgaggcagagaagaatgagcgtgtgcagaag
catctgaaggcccttacttcagagctggccaatgcccgagatgagtccaagaagactgcc
aatgacatgatccatgctgagaacatgcgactgggacgagacaaatacaagaccctgcgc
cagatccggcagggcaacaccaaacaacgcattgatgagtttgagtccatgtag

DBGET integrated database retrieval system