KEGG   Mus musculus (mouse): 17700Help
Entry
17700             CDS       T01002                                 

Gene name
Mstn, Cmpt, Gdf8
Definition
(RefSeq) myostatin
  KO
K05497  growth differentiation factor 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    17700 (Mstn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    17700 (Mstn)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   17700 (Mstn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 17700
NCBI-ProteinID: NP_034964
MGI: 95691
Ensembl: ENSMUSG00000026100
Vega: OTTMUSG00000046890
UniProt: O08689 Q540E2
Structure
PDB: 

Position
1 C1.1; 1 26.99 cM
AA seq 376 aa AA seqDB search
MMQKLQMYVYIYLFMLIAAGPVDLNEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQ
ILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETII
TMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKP
MKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAV
TFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWII
APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQI
IYGKIPAMVVDRCGCS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaaactgcaaatgtatgtttatatttacctgttcatgctgattgctgctggc
ccagtggatctaaatgagggcagtgagagagaagaaaatgtggaaaaagaggggctgtgt
aatgcatgtgcgtggagacaaaacacgaggtactccagaatagaagccataaaaattcaa
atcctcagtaagctgcgcctggaaacagctcctaacatcagcaaagatgctataagacaa
cttctgccaagagcgcctccactccgggaactgatcgatcagtacgacgtccagagggat
gacagcagtgatggctctttggaagatgacgattatcacgctaccacggaaacaatcatt
accatgcctacagagtctgactttctaatgcaagcggatggcaagcccaaatgttgcttt
tttaaatttagctctaaaatacagtacaacaaagtagtaaaagcccaactgtggatatat
ctcagacccgtcaagactcctacaacagtgtttgtgcaaatcctgagactcatcaaaccc
atgaaagacggtacaaggtatactggaatccgatctctgaaacttgacatgagcccaggc
actggtatttggcagagtattgatgtgaagacagtgttgcaaaattggctcaaacagcct
gaatccaacttaggcattgaaatcaaagctttggatgagaatggccatgatcttgctgta
accttcccaggaccaggagaagatgggctgaatccctttttagaagtcaaggtgacagac
acacccaagaggtcccggagagactttgggcttgactgcgatgagcactccacggaatcc
cggtgctgccgctaccccctcacggtcgattttgaagcctttggatgggactggattatc
gcacccaaaagatataaggccaattactgctcaggagagtgtgaatttgtgtttttacaa
aaatatccgcatactcatcttgtgcaccaagcaaaccccagaggctcagcaggcccttgc
tgcactccgacaaaaatgtctcccattaatatgctatattttaatggcaaagaacaaata
atatatgggaaaattccagccatggtagtagaccgctgtgggtgctcatga

DBGET integrated database retrieval system