KEGG   Mus musculus (house mouse): 17701
Entry
17701             CDS       T01002                                 
Symbol
Msx1, Hox-7, Hox7, Hox7.1, msh
Name
(RefSeq) msh homeobox 1
  KO
K09341  homeobox protein MSX
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17701 (Msx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17701 (Msx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    17701 (Msx1)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 17701
NCBI-ProteinID: NP_034965
MGI: 97168
Ensembl: ENSMUSG00000048450
UniProt: P13297
Structure
Position
5:complement(37977835..37981929)
AA seq 303 aa
MAPAAAMTSLPLGVKVEDSAFAKPAGGGVGQAPGAAAATATAMGTDEEGAKPKVPASLLP
FSVEALMADHRKPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSV
GGLLKLPEDALVKAESPEKLDRTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFT
TAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKM
AAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYSASGPFQRAALPVAPVGLYTAHVGYSMY
HLT
NT seq 912 nt   +upstreamnt  +downstreamnt
atggccccggctgctgctatgacttctttgccactcggtgtcaaagtggaggactccgcc
ttcgccaagcctgctgggggaggcgttggccaagcccccggggctgctgcggccaccgca
accgccatgggcacagatgaggagggggccaagcccaaagtgcccgcttcactcctgccc
ttcagcgtggaggccctcatggccgatcacaggaagcccggggccaaggagagcgtcctg
gtggcctccgaaggggctcaggcagcgggtggctcggtgcagcacttgggcacccggccc
gggtctctgggcgccccggatgcgccctcctcgccgcggcctctcggccatttctcagtc
ggaggactcctcaagctgccagaagatgctctggtgaaggccgaaagccccgagaaacta
gatcggaccccgtggatgcagagtccccgcttctccccgcccccagccagacggctgagt
cccccagcatgcaccctacgcaagcacaagaccaaccgcaagcccaggacgcctttcacc
acagctcagctgctggctctggagcgcaagttccgccagaagcagtacctgtctattgcc
gagcgcgcggaattctccagctcgctcagcctcaccgagacccaggtgaagatctggttc
cagaaccgtcgcgctaaggccaagagactgcaggaggcggagctggagaagctgaagatg
gccgcgaaacccatgttgccgcctgctgccttcggcctctcttttcctcttggcggtcct
gcagcggtggctgcagctgcgggcgcctcactctacagtgcctctggccctttccagcgc
gccgcgctgcctgtagcgcccgtgggactctacaccgcccatgtaggctacagcatgtac
cacctgacttag

DBGET integrated database retrieval system