KEGG   Mus musculus (mouse): 17709Help
Entry
17709             CDS       T01002                                 

Gene name
COX2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17709 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17709 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    17709 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    17709 (COX2)
   05012 Parkinson disease
    17709 (COX2)
   05016 Huntington disease
    17709 (COX2)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    17709 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17709 (COX2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    17709 (COX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX2 COX2_TM
Motif
Other DBs
NCBI-GeneID: 17709
NCBI-ProteinID: NP_904331
MGI: 102503
UniProt: P00405 Q7JCZ1
Position
MT
AA seq 227 aa AA seqDB search
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS
YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctacccattccaacttggtctacaagacgccacatcccctattatagaagagcta
ataaatttccatgatcacacactaataattgttttcctaattagctccttagtcctctat
atcatctcgctaatattaacaacaaaactaacacatacaagcacaatagatgcacaagaa
gttgaaaccatttgaactattctaccagctgtaatccttatcataattgctctcccctct
ctacgcattctatatataatagacgaaatcaacaaccccgtattaaccgttaaaaccata
gggcaccaatgatactgaagctacgaatatactgactatgaagacctatgctttgattca
tatataatcccaacaaacgacctaaaacctggtgaactacgactgctagaagttgataac
cgagtcgttctgccaatagaacttccaatccgtatattaatttcatctgaagacgtcctc
cactcatgagcagtcccctccctaggacttaaaactgatgccatcccaggccgactaaat
caagcaacagtaacatcaaaccgaccagggttattctatggccaatgctctgaaatttgt
ggatctaaccatagctttatgcccattgtcctagaaatggttccactaaaatatttcgaa
aactgatctgcttcaataatttaa

DBGET integrated database retrieval system