KEGG   Mus musculus (mouse): 17711
Entry
17711             CDS       T01002                                 

Gene name
CYTB
Definition
(RefSeq) cytochrome b
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00151  Cytochrome bc1 complex respiratory unit
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17711 (CYTB)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17711 (CYTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    17711 (CYTB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17711 (CYTB)
   05012 Parkinson disease
    17711 (CYTB)
   05014 Amyotrophic lateral sclerosis
    17711 (CYTB)
   05016 Huntington disease
    17711 (CYTB)
   05020 Prion disease
    17711 (CYTB)
   05022 Pathways of neurodegeneration - multiple diseases
    17711 (CYTB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17711 (CYTB)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    17711 (CYTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17711 (CYTB)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    17711 (CYTB)
SSDB
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Other DBs
NCBI-GeneID: 17711
NCBI-ProteinID: NP_904340
MGI: 102501
UniProt: P00158 Q7JCZ3
Position
MT
AA seq 381 aa
MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTM
TAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYYGSYTFMETWNIGVLLL
FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFA
FHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILM
TLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILI
LALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFS
IILILMPISGIIEDKMLKLYP
NT seq 1144 nt   +upstreamnt  +downstreamnt
atgacaaacatacgaaaaacacacccattatttaaaattattaaccactcattcattgac
ctacctgccccatccaacatttcatcatgatgaaactttgggtcccttctaggagtctgc
ctaatagtccaaatcattacaggtcttttcttagccatacactacacatcagatacaata
acagccttttcatcagtaacacacatttgtcgagacgtaaattacgggtgactaatccga
tatatacacgcaaacggagcctcaatattttttatttgcttattccttcatgtcggacga
ggcttatattatggatcatatacatttatagaaacctgaaacattggagtacttctactg
ttcgcagtcatagccacagcatttataggctacgtccttccatgaggacaaatatcattc
tgaggtgccacagttattacaaacctcctatcagccatcccatatattggaacaacccta
gtcgaatgaatttgagggggcttctcagtagacaaagccaccttgacccgattcttcgct
ttccacttcatcttaccatttattatcgcggccctagcaatcgttcacctcctcttcctc
cacgaaacaggatcaaacaacccaacaggattaaactcagatgcagataaaattccattt
cacccctactatacaatcaaagatatcctaggtatcctaatcatattcttaattctcata
accctagtattatttttcccagacatactaggagacccagacaactacataccagctaat
ccactaaacaccccaccccatattaaacccgaatgatatttcctatttgcatacgccatt
ctacgctcaatccccaataaactaggaggtgtcctagccttaatcttatctatcctaatt
ttagccctaatacctttccttcatacctcaaagcaacgaagcctaatattccgcccaatc
acacaaattttgtactgaatcctagtagccaacctacttatcttaacctgaattgggggc
caaccagtagaacacccatttattatcattggccaactagcctccatctcatacttctca
atcatcttaattcttataccaatctcaggaattatcgaagacaaaatactaaaattatat
ccat

KEGG   Mus musculus (mouse): 22272
Entry
22272             CDS       T01002                                 

Gene name
Uqcrq, 1100001F06Rik, 1500040F11Rik, 5830407L17Rik, 9.5kDa, AA959903, QP-, QP-C, Qp, Qpc, Uqcrb, c1502
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit VII
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    22272 (Uqcrq)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    22272 (Uqcrq)
  09159 Environmental adaptation
   04714 Thermogenesis
    22272 (Uqcrq)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22272 (Uqcrq)
   05012 Parkinson disease
    22272 (Uqcrq)
   05014 Amyotrophic lateral sclerosis
    22272 (Uqcrq)
   05016 Huntington disease
    22272 (Uqcrq)
   05020 Prion disease
    22272 (Uqcrq)
   05022 Pathways of neurodegeneration - multiple diseases
    22272 (Uqcrq)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    22272 (Uqcrq)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    22272 (Uqcrq)
SSDB
Motif
Pfam: UcrQ Cyt_b-c1_8
Other DBs
NCBI-GeneID: 22272
NCBI-ProteinID: NP_001313543
MGI: 107807
Ensembl: ENSMUSG00000044894
Vega: OTTMUSG00000000054
UniProt: Q9CQ69
Position
11; 11 B1.3
AA seq 82 aa
MGREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIY
TWGNQEFEQSKRKNPAMYENDK
NT seq 249 nt   +upstreamnt  +downstreamnt
atgggccgcgagtttgggaacctggcgcggatacggcacgtgatctcctacagcttgtcg
ccctttgagcagcgcgccttcccaagctatttcagcaaaggcatccccaacgtgctgcgc
cgcactcgcgagcgcatcctgcgcgtggcgccgccgtttgtagtggtctacctgatctac
acatggggcaaccaggagtttgagcagtcgaaaaggaagaatccagccatgtatgaaaat
gacaagtag

KEGG   Mus musculus (mouse): 22273
Entry
22273             CDS       T01002                                 

Gene name
Uqcrc1, 1110032G10Rik
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 1
  KO
K00414  ubiquinol-cytochrome c reductase core subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    22273 (Uqcrc1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    22273 (Uqcrc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    22273 (Uqcrc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22273 (Uqcrc1)
   05012 Parkinson disease
    22273 (Uqcrc1)
   05014 Amyotrophic lateral sclerosis
    22273 (Uqcrc1)
   05016 Huntington disease
    22273 (Uqcrc1)
   05020 Prion disease
    22273 (Uqcrc1)
   05022 Pathways of neurodegeneration - multiple diseases
    22273 (Uqcrc1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    22273 (Uqcrc1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    22273 (Uqcrc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    22273 (Uqcrc1)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   22273 (Uqcrc1)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C M16C_assoc
Other DBs
NCBI-GeneID: 22273
NCBI-ProteinID: NP_079683
MGI: 107876
Ensembl: ENSMUSG00000025651
Vega: OTTMUSG00000051043
UniProt: Q9CZ13
Position
9 F2; 9 59.63 cM
AA seq 480 aa
MAASAVCRAACSGTQVLLRTRRSPALLRLPALRGTATFAQALQSVPETQVSILDNGLRVA
SEQSSHATCTVGVWIDAGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHL
NAYSTREHTAYLIKALSKDLPKVVELLADIVQNSSLEDSQIEKERDVILREMQENDASMQ
NVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNRHYKAPRMVLAAAGGVEHQ
QLLDLAQKHLSSVSRVYEEDAVPGLTPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPD
NVTLQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSDTGLLGAHFVC
DAMSIDDMVFFLQGQWMRLCTSATESEVTRGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIQEVDAQMLRDICSKYFYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcggcgtccgcagtctgccgagcggcctgctccgggacgcaagtgctacttcgcacc
cgccgctcgccggccctgctgaggttacctgccttgcggggtaccgcaaccttcgcccag
gccctccagagcgtgccggagacccaggtcagcatcttggacaacgggctgcgtgtggcc
tcggagcagtcctcgcatgctacctgcacggtgggagtgtggattgacgctggcagtcgc
tatgagactgagaagaacaatggagcaggctactttttggaacatctggctttcaaggga
acaaagaatcggcctggcaatgccttagagaaggaggtagagagtattggggctcatctt
aatgcctacagcactcgagagcacactgcttacctcatcaaggcactgtccaaggacctg
ccaaaagttgtggagctcctggcagatatcgtgcagaacagtagtctggaagactcacag
atcgagaaggaacgagatgtgatcctgcgggagatgcaggaaaatgacgcctccatgcag
aacgtggtctttgattacctgcatgcgacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgagaacgtcaggaggctgtcgcgcacagacttgactgactacctc
aacagacattacaaagccccccggatggtgctggctgcagctggaggtgtggaacaccag
cagctgctggaccttgcccagaaacacttgagcagtgtctcccgagtgtatgaagaagat
gccgtgcctggtctcactccatgtcgcttcactggcagtgagatccgccatcgcgatgac
gccctgcctttggcccacgtggccattgcagtagagggacctggctgggctaacccagac
aacgtgaccctccaagtggccaatgccatcataggccactatgactgcacttacggtggt
ggagtgcacctgtcaagcccgctggcttccgttgctgtggctaacaagctttgccagagt
ttccagaccttcaacatctcctactctgatactgggctgctgggcgcacactttgtctgt
gatgccatgagtatcgatgacatggtcttcttcctgcaaggccagtggatgcgcctatgt
accagtgctacagagagtgaggtgactcggggcaaaaacatccttaggaatgctttggtg
tctcatttggatggcaccacccctgtgtgtgaagacattggtcgcagtctcctgacttat
ggccgccgcatccctctggctgagtgggagagccggattcaggaggtggatgcccagatg
ctgcgtgacatttgctccaagtacttttatgaccaatgtccagcagtggctggctatggc
cccatcgagcagctcccagactacaaccggatccgcagtggcatgttctggctgcgcttc
tag

KEGG   Mus musculus (mouse): 66152
Entry
66152             CDS       T01002                                 

Gene name
Uqcr10, 1110020P15Rik, AA960494, Ucrc
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit X
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66152 (Uqcr10)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    66152 (Uqcr10)
  09159 Environmental adaptation
   04714 Thermogenesis
    66152 (Uqcr10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66152 (Uqcr10)
   05012 Parkinson disease
    66152 (Uqcr10)
   05014 Amyotrophic lateral sclerosis
    66152 (Uqcr10)
   05016 Huntington disease
    66152 (Uqcr10)
   05020 Prion disease
    66152 (Uqcr10)
   05022 Pathways of neurodegeneration - multiple diseases
    66152 (Uqcr10)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66152 (Uqcr10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66152 (Uqcr10)
SSDB
Motif
Pfam: UCR_UQCRX_QCR9
Other DBs
NCBI-GeneID: 66152
NCBI-ProteinID: NP_932096
MGI: 1913402
Ensembl: ENSMUSG00000059534
Vega: OTTMUSG00000005067
UniProt: Q8R1I1 Q5NCJ9
Position
11; 11 A1
AA seq 64 aa
MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKY
ENKE
NT seq 195 nt   +upstreamnt  +downstreamnt
atgtcgtcgccgacgatcccttcgcgcctgtactccttgctgttccgcagaacttccacc
tttgccctcaccatcgcagtgggcgccctgttcttcgagcgagccttcgatcagggcgca
gacgcgatctacgagcacatcaacgaggggaaactgtggaaacatataaagcacaagtat
gagaacaaggagtaa

KEGG   Mus musculus (mouse): 66445
Entry
66445             CDS       T01002                                 

Gene name
Cyc1, 2610002H19Rik, AA408921, Cyct1
Definition
(RefSeq) cytochrome c-1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00151  Cytochrome bc1 complex respiratory unit
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66445 (Cyc1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    66445 (Cyc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    66445 (Cyc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66445 (Cyc1)
   05012 Parkinson disease
    66445 (Cyc1)
   05014 Amyotrophic lateral sclerosis
    66445 (Cyc1)
   05016 Huntington disease
    66445 (Cyc1)
   05020 Prion disease
    66445 (Cyc1)
   05022 Pathways of neurodegeneration - multiple diseases
    66445 (Cyc1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66445 (Cyc1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66445 (Cyc1)
SSDB
Motif
Pfam: Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-GeneID: 66445
NCBI-ProteinID: NP_079843
MGI: 1913695
Ensembl: ENSMUSG00000022551
UniProt: Q9D0M3
Position
15; 15 D3
AA seq 325 aa
MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAVSLSSKSGPSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYP
NPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLL
PLTYAMKRHKWSVLKSRKLAYRPPK
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcttcgcttcgccggacggtactgggcccgcggggcgtggggctt
ccaggtgcaagtgctccgggtctgctgggcggcgcgcggtcccggcagcttccattgcgg
acaccgcaggcagtgtccttgtcctcgaagtctggcccttctcgaggccgaaaggtgatg
ctgtcagcgttgggcatgctggccgcggggggtgcagggctagctgtggcccttcattct
gccgtgagtgccagtgacctggagctgcacccccccagctacccatggtctcatcgtggc
ctcctctcctccttggaccacaccagcattcggaggggtttccaggtatacaagcaggtg
tgctcttcctgccacagcatggattatgtggcgtaccgccacctggtgggagtgtgctac
acggaggaagaagccaaggcgctggctgaggaggtggaggtccaggatggccctaatgat
gatggggagatgttcatgcggccagggaagttgtctgactattttccaaaaccataccct
aaccctgaggctgcaagagctgctaacaatggagctttaccccctgacctcagctacatc
gttcgagctaggcatggtggtgaggactacgtattttccctgctcactggctactgtgag
ccccccactggggtgtcattgcgagaaggcctctatttcaacccttactttcccggccag
gccattggcatggctcctcccatctacacagaagtcttggagtatgatgatggcacccca
gctaccatgtcacaagtagctaaggatgtcgccaccttccttcgctgggcatcagaacca
gagcatgaccatcgaaaacgcatgggtctcaagatgttgttgatgatgggcctgctgctg
cccctgacctatgccatgaagcggcataagtggtcagtcctgaagagtcgaaagctggct
tatcggccacccaagtga

KEGG   Mus musculus (mouse): 66576
Entry
66576             CDS       T01002                                 

Gene name
Uqcrh, 2210416J04Rik, 2310021J10Rik, 2610041P16Rik
Definition
(RefSeq) ubiquinol-cytochrome c reductase hinge protein
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66576 (Uqcrh)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    66576 (Uqcrh)
  09159 Environmental adaptation
   04714 Thermogenesis
    66576 (Uqcrh)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66576 (Uqcrh)
   05012 Parkinson disease
    66576 (Uqcrh)
   05014 Amyotrophic lateral sclerosis
    66576 (Uqcrh)
   05016 Huntington disease
    66576 (Uqcrh)
   05020 Prion disease
    66576 (Uqcrh)
   05022 Pathways of neurodegeneration - multiple diseases
    66576 (Uqcrh)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66576 (Uqcrh)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66576 (Uqcrh)
SSDB
Motif
Pfam: UCR_hinge
Other DBs
NCBI-GeneID: 66576
NCBI-ProteinID: NP_079917
MGI: 1913826
Ensembl: ENSMUSG00000063882
Vega: OTTMUSG00000008727
UniProt: P99028
Position
4; 4 D1
AA seq 89 aa
MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQ
TEEDCTEELFDFLHARDHCVAHKLFKNLK
NT seq 270 nt   +upstreamnt  +downstreamnt
atgggactagaggacgaacgaaagatgctcactggatctggagaccccaaagaggaagaa
gaggaagaactagtggaccccctaacaacagtgagagagcactgtgaacagctggagaag
tgtgtaaaggcccgggaacgactagagttgtgtgataatcgcgtgtcttcccggtcacag
acagaagaggattgtacagaggagctctttgacttcttgcatgcacgggaccactgtgtg
gcccacaagctctttaaaaacttgaagtaa

KEGG   Mus musculus (mouse): 66594
Entry
66594             CDS       T01002                                 

Gene name
Uqcr11, 0710008D09Rik, AL022707, Uqc, Uqcr
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit XI
  KO
K00420  ubiquinol-cytochrome c reductase subunit 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66594 (Uqcr11)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    66594 (Uqcr11)
  09159 Environmental adaptation
   04714 Thermogenesis
    66594 (Uqcr11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66594 (Uqcr11)
   05012 Parkinson disease
    66594 (Uqcr11)
   05014 Amyotrophic lateral sclerosis
    66594 (Uqcr11)
   05016 Huntington disease
    66594 (Uqcr11)
   05020 Prion disease
    66594 (Uqcr11)
   05022 Pathways of neurodegeneration - multiple diseases
    66594 (Uqcr11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66594 (Uqcr11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66594 (Uqcr11)
SSDB
Motif
Pfam: UCR_6-4kD QCR10
Other DBs
NCBI-GeneID: 66594
NCBI-ProteinID: NP_079926
MGI: 1913844
Ensembl: ENSMUSG00000020163
Vega: OTTMUSG00000019123
UniProt: Q9CPX8
Position
10; 10 C1
AA seq 56 aa
MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKDD
NT seq 171 nt   +upstreamnt  +downstreamnt
atgctgagcaggtttctaggcccgcgctaccgggaactggccagaaactggattcccaca
gccggcatgtggggcactgtgggtgccgtgggactggtgtgggccacggactggcggctg
atcctggactgggtgccttacatcaacggcaagtttaagaaggacgattag

KEGG   Mus musculus (mouse): 66694
Entry
66694             CDS       T01002                                 

Gene name
Uqcrfs1, 4430402G14Rik, AI875505
Definition
(RefSeq) ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00151  Cytochrome bc1 complex respiratory unit
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66694 (Uqcrfs1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    66694 (Uqcrfs1)
  09159 Environmental adaptation
   04714 Thermogenesis
    66694 (Uqcrfs1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66694 (Uqcrfs1)
   05012 Parkinson disease
    66694 (Uqcrfs1)
   05014 Amyotrophic lateral sclerosis
    66694 (Uqcrfs1)
   05016 Huntington disease
    66694 (Uqcrfs1)
   05020 Prion disease
    66694 (Uqcrfs1)
   05022 Pathways of neurodegeneration - multiple diseases
    66694 (Uqcrfs1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66694 (Uqcrfs1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66694 (Uqcrfs1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     66694 (Uqcrfs1)
SSDB
Motif
Pfam: UCR_TM Ubiq-Cytc-red_N Rieske
Other DBs
NCBI-GeneID: 66694
NCBI-ProteinID: NP_079986
MGI: 1913944
Ensembl: ENSMUSG00000038462
Vega: OTTMUSG00000000670
UniProt: Q9CR68
Position
13; 13 A3.2
AA seq 274 aa
MLSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAA
ARPLVATVGLNVPASVRFSHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTAT
TTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIDQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVVG
NT seq 825 nt   +upstreamnt  +downstreamnt
atgttgtcggtcgccgcccgctcgggcccgttcgcgcccgtcctatcggccacttcccgc
ggggtggcgggcgcgctgcgtcctctgctgcaaggcgcggtgcccgccgcctcggagcca
cctgttctggatgtgaagcgacccttcctgtgccgcgagtccctgagtggccaggccgca
gcccggcctttggtggccacggtgggcctgaacgttcctgcttctgtccgtttttcccat
acagatgtcaaggtgcccgacttctctgactatcgtcgtgctgaagttcttgatagcaca
aaatcttctaaagaaagcagtgaggctagaaaaggcttctcttacctggtaactgcaact
actactgtgggtgttgcttatgcggccaaaaatgtggtctcccagtttgtttccagcatg
agtgcttctgctgacgtactggccatgtcgaagatcgagatcaagttgtctgatatccct
gaagggaagaacatggcttttaaatggagaggcaaacctctgtttgtgcgccatagaacc
aagaaggagattgaccaggaagctgcagtcgaagtgtcccagttaagggacccacagcat
gatttagatcgagtaaagaaacctgaatgggttattctgataggtgtctgtactcatctt
ggttgtgtacccattgcaaacgcaggagattttggtggctattattgcccctgccatggg
tcacactatgacgcctctggcaggatcaggaagggccctgcacctctcaacctggaagtg
cctgcctacgagttcaccagtgatgatgtagttgttgtgggttag

KEGG   Mus musculus (mouse): 67003
Entry
67003             CDS       T01002                                 

Gene name
Uqcrc2, 1500004O06Rik
Definition
(RefSeq) ubiquinol cytochrome c reductase core protein 2
  KO
K00415  ubiquinol-cytochrome c reductase core subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67003 (Uqcrc2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    67003 (Uqcrc2)
  09159 Environmental adaptation
   04714 Thermogenesis
    67003 (Uqcrc2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67003 (Uqcrc2)
   05012 Parkinson disease
    67003 (Uqcrc2)
   05014 Amyotrophic lateral sclerosis
    67003 (Uqcrc2)
   05016 Huntington disease
    67003 (Uqcrc2)
   05020 Prion disease
    67003 (Uqcrc2)
   05022 Pathways of neurodegeneration - multiple diseases
    67003 (Uqcrc2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67003 (Uqcrc2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67003 (Uqcrc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    67003 (Uqcrc2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   67003 (Uqcrc2)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C DUF1471
Other DBs
NCBI-GeneID: 67003
NCBI-ProteinID: NP_080175
MGI: 1914253
Ensembl: ENSMUSG00000030884
Vega: OTTMUSG00000025574
UniProt: Q9DB77
Position
7; 7 F2
AA seq 453 aa
MKLLSRAGSFSRFYSLKVAPKVKTSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSR
IGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMA
YTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDV
AYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNM
RGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIK
RGNNTTSLLSQSVAKGSHQPFDVSAFNASYSDSGLFGIYTISQAAAAGEVINAAYNQVKA
VAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALAAGSYMPPSTVLQQIDSVA
DADVVKAAKKFVSGKKSMAASGNLGHTPFLDEL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaagctcctcagcagggccgggtccttctcgagattttattccctcaaagttgccccg
aaggttaaaacttcagcagcccctggaggagtgcctctgcagcctcaggatcttgagttt
accaaattaccaaatggtttggtgattgcttctctggaaaactatgctcctctgtcaaga
atcggcttgttcgttaaagcaggcagtagatatgaggactccaacaacttgggaacctca
catttactacgtcttgcatctagtttgactaccaaaggagcttcatctttcaagataacc
cgtgggattgaagcagttggtggtaaattaagtgtgactgcaacaagggaaaacatggcg
tacactgtagaaggcattcggagtgatattgagatcctcatggagttcctgctcaatgtc
accacagcacccgagtttcgccgttgggaagtagctgccctgcggtctcagctaaagatt
gacaaagctgttgcctttcagaattcacagacccgtatcattgagaacttgcatgatgtt
gcctacaagaatgccttggctaatcctttgtactgtcctgactataggatggggaagata
acatcagaggaattacattactttgttcagaaccacttcacaagtgcaagaatggctctg
gttggacttggtgtgagtcattctgtcttaaagcaggtggctgaacaatttctcaacatg
aggggtggccttggtttagctggtgcaaaagccaaataccgtggaggtgaaattagagag
cagaatggagacaacctggtccatgctgctattgttgcagaaagtgctgccattggaaat
gcagaggcaaatgcattcagtgtacttcagcatcttcttggtgctggaccacatatcaaa
aggggcaacaacaccaccagcctcctgagccagagtgttgccaaaggaagtcaccagcct
tttgatgtttctgcatttaatgccagttactcagactctgggctctttggaatttacact
atttcccaggctgcagctgctggagaggttatcaatgctgcctacaaccaagtcaaagca
gttgctcaaggaaacctttccagtgcagatgtccaagctgccaagaacaagctaaaagct
ggatatctaatgtctgtggagacgtcagagggcttcctgagtgaaattgggtcacaggct
ctagctgcaggttcttatatgccaccttctaccgtccttcaacagattgactccgtggct
gatgctgatgttgtaaaggctgcaaaaaagtttgtttctggcaagaagtcaatggcagcg
agtggaaacttgggacatacgccttttctcgacgagttataa

KEGG   Mus musculus (mouse): 67530
Entry
67530             CDS       T01002                                 

Gene name
Uqcrb, 2210415M14Rik, QP-, QP-C, QPC, UQBC, UQBP, UQPC
Definition
(RefSeq) ubiquinol-cytochrome c reductase binding protein
  KO
K00417  ubiquinol-cytochrome c reductase subunit 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67530 (Uqcrb)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    67530 (Uqcrb)
  09159 Environmental adaptation
   04714 Thermogenesis
    67530 (Uqcrb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67530 (Uqcrb)
   05012 Parkinson disease
    67530 (Uqcrb)
   05014 Amyotrophic lateral sclerosis
    67530 (Uqcrb)
   05016 Huntington disease
    67530 (Uqcrb)
   05020 Prion disease
    67530 (Uqcrb)
   05022 Pathways of neurodegeneration - multiple diseases
    67530 (Uqcrb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67530 (Uqcrb)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67530 (Uqcrb)
SSDB
Motif
Pfam: UCR_14kD
Other DBs
NCBI-GeneID: 67530
NCBI-ProteinID: NP_080495
MGI: 1914780
Ensembl: ENSMUSG00000021520
Vega: OTTMUSG00000037036
UniProt: Q9CQB4
Position
13; 13 B3
AA seq 111 aa
MAGRSAVSASSKWLDGFRKWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRM
FRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK
NT seq 336 nt   +upstreamnt  +downstreamnt
atggcgggccgatctgctgtttcagcatcaagcaagtggctggatggttttcgaaagtgg
tattataatgctgcaggattcaataaactggggttaatgcgagatgatacactacatgaa
actgaagatgtaaaagaagccataagaaggcttcctgaggacctttataatgacaggatg
tttcgaattaagagagccctggacctgactatgaggcatcagatcttgcctaaggatcag
tggacaaaatatgaggaggacaaattctaccttgaaccctatctaaaagaggttattcgg
gaaagaaaggagagagaagagtgggcaaagaagtga

DBGET integrated database retrieval system