KEGG   Mus musculus (mouse): 17719
Entry
17719             CDS       T01002                                 

Gene name
ND4
Definition
(RefSeq) NADH dehydrogenase subunit 4
  KO
K03881  NADH-ubiquinone oxidoreductase chain 4 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17719 (ND4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17719 (ND4)
  09159 Environmental adaptation
   04714 Thermogenesis
    17719 (ND4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17719 (ND4)
   05012 Parkinson disease
    17719 (ND4)
   05014 Amyotrophic lateral sclerosis
    17719 (ND4)
   05016 Huntington disease
    17719 (ND4)
   05020 Prion disease
    17719 (ND4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17719 (ND4)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17719 (ND4)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17719 (ND4)
SSDB
Motif
Pfam: Proton_antipo_M Oxidored_q5_N
Other DBs
NCBI-GeneID: 17719
NCBI-ProteinID: NP_904337
MGI: 102498
UniProt: P03911 Q7JCY6
Structure
PDB: 
6G2J 6G72

Position
MT
AA seq 459 aa
MLKIILPSLMLLPLTWLSSPKKTWTNVTSYSFLISLTSLTLLWQTDENYKNFSNMFSSDP
LSTPLIILTAWLLPLMLMASQNHLKKDNNVLQKLYISMLISLQILLIMTFSATELIMFYI
LFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGSIPLLIALILIQNHVGTLNLMILS
FTTHTLDASWSNNLLWLACMMAFLIKMPLYGVHLWLPKAHVEAPIAGSMILAAILLKLGS
YGMIRISIILDPLTKYMAYPFILLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIAS
IMIQTPWSFMGATMLMIAHGLTSSLLFCLANSNYERIHSRTMIMARGLQMVFPLMATWWL
MASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLT
NHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM
NT seq 1378 nt   +upstreamnt  +downstreamnt
atgctaaaaattattcttccctcactaatgctactaccactaacctgactatcaagccct
aaaaaaacctgaacaaacgtaacctcatatagttttctaattagtttaaccagcctaaca
cttctatgacaaaccgacgaaaattataaaaacttttcaaatatattctcctcagacccc
ctatccacaccattaattattttaacagcctgattactgccactaatattaatagctagc
caaaaccacctaaaaaaagataataacgtactacaaaaactctacatctcaatactaatc
agcttacaaattctcctaatcataaccttttcagcaactgaactaattatattttatatt
ttatttgaagcaaccttaatcccaacacttattattattacccgatgagggaaccaaact
gaacgcctaaacgcagggatttatttcctattttataccctaatcggttctattccactg
ctaattgccctcatcttaatccaaaaccatgtaggaaccctaaacctcataattttatca
ttcacaacacacaccttagacgcttcatgatctaacaacttactatggttggcatgcata
atagcatttcttattaaaataccattatatggagttcacctatgactaccaaaagcccat
gttgaagctccaattgctgggtcaataattctagcagctattcttctaaaattaggtagt
tacggaataattcgcatctccattattctagacccactaacaaaatatatagcatacccc
ttcatccttctctccctatgaggaataattataactagctcaatctgcttacgccaaaca
gatttaaaatcactaatcgcctactcctcagttagccacatagcacttgttattgcatca
atcataatccaaactccatgaagcttcataggagcaacaatactaataatcgcacatggc
ctcacatcatcactcctattctgcctagcaaactccaactacgaacggatccacagccgt
actataatcatggcccgaggacttcaaatggtcttcccacttatagccacatgatgactg
atagcaagtctagctaatctagctctacccccttcaatcaatctaataggagaattattc
attaccatatcattattttcttgatcaaactttaccattattcttataggaattaacatt
attattacaggtatatactcaatatacataattattaccacccaacgcggcaaactaacc
aaccatataattaacctccaaccctcacacacacgagaactaacactaatagcccttcac
ataattccacttattcttctaactaccagtccaaaactaattacaggcctgacaatat

DBGET integrated database retrieval system