KEGG   Mus musculus (mouse): 17721Help
Entry
17721             CDS       T01002                                 

Gene name
ND5
Definition
(RefSeq) NADH dehydrogenase subunit 5
  KO
K03883  NADH-ubiquinone oxidoreductase chain 5 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05012  Parkinson disease
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17721 (ND5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17721 (ND5)
  09159 Environmental adaptation
   04714 Thermogenesis
    17721 (ND5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    17721 (ND5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17721 (ND5)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17721 (ND5)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17721 (ND5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proton_antipo_M NADH5_C Proton_antipo_N
Motif
Other DBs
NCBI-GeneID: 17721
NCBI-ProteinID: NP_904338
MGI: 102496
UniProt: P03921 Q9MD82
Structure
PDB: 

Position
MT
AA seq 607 aa AA seqDB search
MNIFTTSILLIFILLLSPILISMSNLIKHINFPLYTTTSIKFSFIISLLPLLMFFHNNME
YMITTWHWVTMNSMELKMSFKTDFFSILFTSVALFVTWSIMQFSSWYMHSDPNINRFIKY
LTLFLITMLILTSANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDI
GFILAMVWFSLNMNSWELQQIMFSNNNDNLIPLMGLLIAATGKSAQFGLHPWLPSAMEGP
TPVSALLHSSTMVVAGIFLLVRFHPLTTNNNFILTTMLCLGALTTLFTAICALTQNDIKK
IIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAMLFMCSGSIIHSLADEQDIRKMG
NITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLIIEAINTCNTNAWALLITLIATSMTA
MYSMRIIYFVTMTKPRFPPLISINENDPDLMNPIKRLAFGSIFAGFVISYNIPPTSIPVL
TMPWFLKTTALIISVLGFLIALELNNLTMKLSMNKANPYSSFSTLLGFFPSIIHRITPMK
SLNLSLKTSLTLLDLIWLEKTIPKSTSTLHTNMTTLTTNQKGLIKLYFMSFLINIILIII
LYSINLE
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atcaatattttcacaacctcaatcttattaatcttcattcttctactatccccaatccta
atttcaatatcaaacctaattaaacacatcaacttcccactgtacaccaccacatcaatc
aaattctccttcattattagcctcttacccctattaatatttttccacaataatatagaa
tatataattacaacctggcactgagtcaccataaattcaatagaacttaaaataagcttc
aaaactgactttttctctatcctgtttacatctgtagccctttttgtcacatgatcaatt
atacaattctcttcatgatatatacactcagacccaaacatcaatcgattcattaaatat
cttacactattcctgattaccatgcttatcctcacctcagccaacaacatatttcaactt
ttcattggctgagaaggggtgggaattatatctttcctactaattggatgatggtacgga
cgaacagacgcaaatactgcagccctacaagcaatcctctataaccgcatcggagacatc
ggattcattttagctatagtttgattttccctaaacataaactcatgagaacttcaacag
attatattctccaacaacaacgacaatctaattccacttataggcctattaatcgcagct
acaggaaaatcagcacaatttggcctccacccatgactaccatcagcaatagaaggccct
acaccagtttcagcactactacactcaagtacaatagtagttgcaggaattttcctactg
gtccgattccaccccctcacgactaataataactttattttaacaactatactttgcctc
ggagccctaaccacattatttacagctatttgtgctctcacccaaaacgacatcaaaaaa
atcattgccttctctacatcaagccaactaggcctgataatagtgacgctaggaataaac
caaccacacctagcattcctacacatctgtacccacgcattcttcaaagctatactcttt
atatgctctggctcaatcattcatagcctggcagacgaacaagacatccgaaaaatagga
aacatcacaaaaatcataccattcacatcatcatgcctagtaatcggaagcctcgccctc
acaggaataccattcctaacagggttctactcaaaagacctaattattgaagcaattaat
acctgcaacaccaacgcctgagccctactaattacactaatcgccacttctataacagct
atgtacagcatacgaatcatttacttcgtaacaataacaaaaccgcgttttcccccccta
atctccattaacgaaaatgacccagacctcataaacccaatcaaacgcctagcattcgga
agcatctttgcaggatttgtcatctcatataatattccaccaaccagcattccagtcctc
acaataccatgatttttaaaaaccacagccctaattatttcagtattaggattcctaatc
gcactagaactaaacaacctaaccataaaactatcaataaataaagcaaatccatattca
tccttctcaactttactggggtttttcccatctattattcaccgcattacacccataaaa
tctctcaacctaagcctaaaaacatccctaactctcctagacttgatctggttagaaaaa
accatcccaaaatccacctcaactcttcacacaaacataaccactttaacaaccaaccaa
aaaggcttaattaaattgtactttatatcattcctaattaacatcatcttaattattatc
ttatactcaattaatctcgagtaa

DBGET integrated database retrieval system