KEGG   Mus musculus (mouse): 17749
Entry
17749             CDS       T01002                                 

Gene name
Polr2k, ABC10-, ABC10-alpha, Maf, MafY, Mt1, Mt1a, RPA, RPABC4, RPB, RPB1, RPB10alpha, RPB12, RPB7, RPB7.0
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide K
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    17749 (Polr2k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    17749 (Polr2k)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    17749 (Polr2k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    17749 (Polr2k)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17749 (Polr2k)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     17749 (Polr2k)
  RNA polymerase III system
   RNA polymerase III
     17749 (Polr2k)
  RNA polymerase I system
   RNA polymerase I
     17749 (Polr2k)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      17749 (Polr2k)
SSDB
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon Cytochrome_C7 DUF5816 MCM_OB HypA DZR zinc_ribbon_13
Other DBs
NCBI-GeneID: 17749
NCBI-ProteinID: NP_075616
MGI: 102725
Ensembl: ENSMUSG00000045996
Vega: OTTMUSG00000042372
UniProt: Q63871 Q8BFX0 Q545V5
Position
15; 15 B3.1
AA seq 58 aa
MDAQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt   +upstreamnt  +downstreamnt
atggacgctcagaaagatgttcaaccaccaaagcagcagccaatgatatatatttgtgga
gagtgtcacaccgaaaatgagataaagtccagggatcccatcagatgcagagaatgtgga
tacagaataatgtacaagaaaaggactaaaagattggtggtttttgatgctcgatga

DBGET integrated database retrieval system