KEGG   Mus musculus (mouse): 17756
Entry
17756             CDS       T01002                                 

Gene name
Map2, G1-397-34, MAP-2, Mtap-2, Mtap2, repro4
Definition
(RefSeq) microtubule-associated protein 2
  KO
K10430  microtubule-associated protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17756 (Map2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     17756 (Map2)
SSDB
Motif
Pfam: MAP2_projctn Tubulin-binding RII_binding_1 DUF4634
Other DBs
NCBI-GeneID: 17756
NCBI-ProteinID: NP_001297563
MGI: 97175
Ensembl: ENSMUSG00000015222
Vega: OTTMUSG00000016448
UniProt: P20357 Q80ZL4 Q3URJ7
Position
1 C3; 1 33.49 cM
AA seq 1828 aa
MADERKDEGKAPHWTSASLTEAAAHPHSPEMKDQGGAGEGLSRNANGFPYREEEEGAFGE
HRSQGTYSDTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQP
AALPLAAEETANLPPSPPPSPASEQTATVEEDLLTASKMEFPEQEKFPSSFAEPLDKGEM
EFKMPSKPGEDFEHAALVPDTSKTPQDKKDLQGMEGEKLPPVPFAQTFGTNLEDRKQSTE
PSIVMPSIGLSAEPPAPKEPKDWFIEMPTESKKDEWGLAAPISPGPLTPMREKDVLEDIP
RWEGKQFDSPMPSPFHGGSFTLPLDTMKNERVSEGPRPFAPVFFQSDDKVSLQDPSALAT
SKESSKDEEPLKDKADKVADVSISEVTTLLGNVHSPVVEGYVGENISGEVKVTTDQEKKE
TSAPSVQEPTLTETEPQTKLDEKSTVSIEEAVAKKEESFKLRDDKTGVIQTSTEQSFSKE
DQKGQEHTIDELKQDSFPISLEQAVTDAAMTSKTLGKVTSEPEAVSERREIQGLFEEKTA
DKNKLEGAGSATIAEVEMPFYEDKSGMSKYFETSALKEDMTRSTELGSDYYELSDSRGSA
QESLDTISPKNQHDEKELQAKASQPSPPAQEAGYSTLAQSYTPDHPSELPEEPSSPQERM
FTIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFG
RGHDLSPLASDILTNTSGSMDEGDDYLPPTTPAVEKMPCFPIESKEEEDKAEQAKVTGGQ
TIQVETSSESPFPAKEYYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSEA
MLAESSTSLPPVADESPVTVKPDSQLEDMGYCVFNKYTVPLPSPVQDSENLSGESGSFYE
GTDDKVRRDLATDLSLIEVKLAAAGRVKDEFTAEKEASPPTSADKSRLSREFDHDRKAND
KLDTVLEKSEEHIDSKEHAKESEEMGGKVELFGLGITYDQASTKELITTKDTSPEKTEKG
LSSVPEVAEVEPTTKADQGLDFAATKAEPSQLDIKVSDFGQMASGMNVDAGKAIELKFEV
AQELTLSSEAPQEADSFMGVESGHIKEGGKVNETEVKEKVTKPDLVHQEAVDKEESYESS
GEHESLTMESLKPDEGKKETSPETSLIQDEVALKLSVEIPCPPPVSEADLSTDEKGEVQM
EFIQLPKEESTETPDIPAIPSDVTQPQPEAIVSEPAEVPSEEEEIEAGGEYDKLLFRSDT
LQISDLLVSESREEFVETCPGELKGVVESVVTIEDDFITVVQTTTDEGESGSHSVRFAAP
AQPEEERRPRPHDEELEIEMAAEAQAEPKDGSPDAPATPEKEEVAFSEYKTETYDDYKDE
TTIDDSIMDADSLWVDTQDDDRSILTEQLETIPKEERAEKDARRPSLEKHRKEKPFKTGR
GRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKSEVQAHSPSRKLILKPAIKYTR
PTHLSCVKRKTTAASGDLAQAPGAFKQAKDKVTDGISKSPEKRSSLPRPSSILPPRRGVS
GDREENSFSLNSSISSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGT
PGTPSYPRTPGTPKSGILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGS
TDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAK
VGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPSRSSVASPRRLSNVSS
SGSINLLESPQLATLAEDVTAALAKQGL
NT seq 5487 nt   +upstreamnt  +downstreamnt
atggccgacgagcggaaagatgaaggaaaggcaccacactggacatcagcctcactcaca
gaggcagctgcacaccctcactctccagagatgaaggaccagggtggggcaggggaaggg
ctgagccgcaacgccaatggatttccatacagagaggaggaggaaggcgcctttggggag
cacaggtcacagggcacctattcagataccaaagagaacgggatcaacggagagctgacc
tcagctgacagagaaacagcagaggaggtatctgcaaggatagttcaagtagtcacagct
gaagctgtagcagtcctgaaaggtgaacaagagaaggaagcccaacacaaggaccagcct
gcagctctgcctctagcagccgaagaaacagctaatctgccaccttcgccaccaccatcg
ccagcctcagaacaaacagccacagtggaggaagatttacttacagcctcgaagatggaa
ttccctgagcaggagaaatttccttcctcattcgctgagcctttagacaagggagaaatg
gagtttaagatgccaagtaagcctggtgaagactttgaacatgctgccttagttcctgac
acaagtaaaactcctcaggataaaaaggatctccaaggcatggaaggagaaaagttgcct
ccagttccatttgcgcagactttcggtaccaacctggaagacagaaaacagagcacagaa
ccaagcatagtgatgcctagcattggcctctcggcagagcccccagctccaaaagagcca
aaagactggttcattgaaatgcccacggaatcaaagaaggatgaatggggtttagctgcc
ccaatatctcctggccccttgacacccatgagggaaaaagatgtgctagaggatatccca
agatgggaagggaagcagtttgactctcccatgccaagccccttccatggtggaagtttc
actcttcccttagacactatgaagaatgagagagtctcagaaggaccacgaccctttgcc
cctgtcttcttccaatcagatgacaaagtgtctctgcaggaccccagtgctctagctact
tccaaagagagttctaaagatgaggagccactgaaagataaagcagacaaagtggcagat
gtttccatctcagaagttaccactttactgggaaatgttcatagtccagttgtggaaggc
tatgttggggagaacatttcaggagaagtaaaggttaccacagatcaagagaaaaaggag
acttctgcacccagtgtacaggaacctacactcactgaaactgaaccacagacaaagctt
gatgagaaatcaactgtttctatcgaagaagctgtggcaaaaaaagaggaatcctttaaa
ctaagagatgataaaacaggtgtaattcagacttccaccgagcagtctttctccaaggaa
gaccagaaaggccaagaacacacgattgatgagttaaaacaagactccttccctataagt
ctggaacaagcagttacagatgcagccatgacctccaagaccttgggaaaagttacatct
gagccagaggcagtaagtgaaaggagagaaatccagggactttttgaagagaaaacagct
gacaaaaataagcttgaaggcgctggatctgcgacaatagccgaggttgagatgccgttt
tatgaagataaatcagggatgtctaagtactttgaaacatctgcattgaaagaagacatg
acgagaagcactgagttgggcagtgattactatgagctgagtgactccagaggaagtgcc
caggaatctcttgatactatatctcctaagaaccaacatgatgaaaaggaacttcaggca
aaagcatcccagcctagtcctccagcacaggaagcagggtacagcactcttgctcagagt
tatacacccgatcatccatccgagttacctgaagaaccaagttctcctcaagagagaatg
ttcactattgaccccaaagtttatggagagaaaagggaccttcatagtaagaataaggac
gatctgacacttagtcgaagcttagggcttggtggaaggtctgcaatagaacaaagaagc
atgtctatcaacttgcctatgtcttgccttgattccattgcccttgggtttaactttggc
cggggccatgatctttcccctctggcttctgatattctaaccaacactagtggaagcatg
gatgaaggagatgattacctgccccccaccacacctgcagtggagaagatgccttgcttt
cctatagagagcaaagaggaagaagataaagcagagcaagcaaaagtgactggagggcaa
actatccaagttgaaacatcctcagagtcaccctttccagccaaagaatattacaaaaat
ggtactgtcatggcccctgacctgcccgagatgctagatctggcaggaaccaggtccaga
ttagcttctgtgagtgcagatgctgaggttgccaggaggaaatcagtcccatcagaggct
atgcttgcagagagtagtaccagtttgccacctgtcgctgatgaaagcccagtcactgta
aaaccagatagtcaacttgaagacatgggatactgtgtgttcaacaagtacacagtccct
ctcccatcaccagttcaagacagtgagaatttgtcaggagagagtggttcattttatgaa
ggaaccgatgacaaagtccgtagagatttggccaccgacctttcactaattgaagtaaaa
cttgcagctgctggaagagtcaaagatgagttcactgctgagaaagaggcatctccaccc
acttctgctgacaaatcaagactgagtagggagtttgaccatgacaggaaagctaatgac
aagctggatactgtcctagaaaagagtgaagagcatattgattcaaaagaacatgccaag
gagtcagaagagatggggggtaaagtagagctctttggattaggtataacttatgatcaa
gcctccaccaaagaactgataacaactaaggatacatcacctgagaaaacagagaaaggt
ctcagttcagtgccagaggtagctgaggtcgagccaaccacaaaagctgatcaaggtcta
gattttgctgcaacgaaagctgagccaagtcagttagatataaaagtcagtgactttgga
cagatggcttctgggatgaatgtagatgctgggaaagccatagagcttaagtttgaggtt
gctcaggagctgacgctctcatccgaagcacctcaagaagcagattccttcatgggtgtt
gagtccggccacatcaaggaaggtggcaaagtcaatgaaacagaagtcaaggaaaaggtg
acaaagcctgatttggtgcatcaggaggctgtagacaaagaagagtcctatgagtctagc
ggtgagcatgaaagcctcactatggagtctctgaagcctgatgagggcaagaaagaaaca
tctccagagacatcactgatccaagatgaagttgccctcaagctgtctgtagaaatccct
tgcccgcctccagtttccgaagctgatttatccacggatgagaagggtgaggtccagatg
gaattcattcagctgccaaaggaagagagcacagagactccggatatacctgccatacct
tctgatgtcacccagccacagcctgaagccattgtgtccgaaccagcagaggtcccaagt
gaggaagaagagatagaagctgggggagagtatgacaaactgctcttccgctcagatacc
ctccagatctccgacctgcttgtttcagaaagtagggaggagtttgtggagacctgccca
ggtgagctcaaaggtgtggttgagtctgtggtgaccattgaggatgattttatcactgta
gtacaaaccacaactgatgagggggagtcggggtcccacagtgtgcgcttcgcagctcca
gctcagccggaggaagaaaggagaccacgccctcacgatgaagagcttgaaatagagatg
gcagcagaagcccaggcagaacccaaggatggctctccagatgctccagctacccctgag
aaagaagaggttgcgttctcagaatataaaacagaaacttacgacgattacaaagacgag
accaccattgatgactccattatggacgccgacagcctgtgggtggacactcaagatgat
gatagaagcatcttgacagagcagttagaaactattcctaaagaggagagagctgagaag
gatgctcggagaccgtctctcgagaaacatagaaaagaaaagccttttaaaaccgggaga
ggcagaatttccactcctgaaagaaaagtagctaaaaaggaacctagcacggtctccagg
gatgaagtgagaaggaaaaaagcagtttataagaaggctgaacttgctaaaaaatcagaa
gttcaggcccactctccttccaggaaactcattttaaaacctgctatcaaatacactaga
ccaactcatctctcctgtgttaagcggaaaaccacagcagcaagtggtgacttggctcag
gctcctggtgcttttaaacaggcgaaggataaagtcactgatggaataagcaagagccca
gagaaacgttcttccctcccaagaccttcctccatcctccctcctcgcaggggtgtatca
ggagacagggaggagaactctttctctctgaatagctccatctcttcagcacgacggacc
accaggtcagaaccaattcgcagagcaggaaaaagtggcacctccacacctactacccct
ggatcaactgcaatcacccctggaactcccccaagctactcttcacgtaccccaggcacc
ccgggaaccccgagctaccccaggacaccaggaacccccaaatctggcatcctggtgccc
agtgagaagaaagttgccatcatccgcactcctccaaagtccccagctactcctaagcag
cttcggcttattaaccaaccactgccggacctgaagaatgtcaagtccaaaatcggatca
actgacaacatcaaataccagcctaaggggggtcaggtacaaattgttactaagaagata
gacttaagccatgtgacatccaaatgtggctctctaaagaacatccgtcacaggccaggt
ggtggacgtgtgaaaattgagagtgtaaaactggatttcaaggaaaaggcccaagctaaa
gttggctcacttgacaatgctcaccacgtacctggaggtggtaatgtgaagattgacagc
caaaagttgaacttcagagagcatgcaaaggcccgggtagatcacggggctgagatcatc
acacagtccccaagcaggtccagcgtggcatcaccccgacgactcagcaacgtctcatct
tctggaagcatcaacctgctcgaatcccctcagcttgccactttggctgaggatgtcact
gcggcgcttgctaagcagggcttgtga

DBGET integrated database retrieval system