KEGG   Mus musculus (house mouse): 17761
Entry
17761             CDS       T01002                                 
Symbol
Map7, E-MAP-115, MAP-7, Mtap7, R75000, mshi, mste, ste
Name
(RefSeq) microtubule-associated protein 7
  KO
K10433  microtubule-associated protein 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17761 (Map7)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     17761 (Map7)
SSDB
Motif
Pfam: MAP7 Orbi_NS1
Other DBs
NCBI-GeneID: 17761
NCBI-ProteinID: NP_032661
MGI: 1328328
Ensembl: ENSMUSG00000019996
UniProt: O88735 E9QMU3
Position
10:20024666..20157336
AA seq 730 aa
MAEQGAGGDGHRGGDGATHSDPASDGYKVQEKRTAPSRPTSTVSGQTSNHSGNKPDPPPV
LRVDDRQRLARERREEREKQLAARETVWLEREERARQHYERHLEARKKKLEDQRLKEERR
RAAVEEKRRQRLEEDKERHEAVVRRTMERSQKPRQKSNRWSWGSPLHGSSSIHSGDPDRR
SVSTMNLSKHVDPVISKRLSSSSATLLNSPDRARRLQLSPWESSVVSRLLTPTHSFLARS
KSTAALSGDTASCSPIIMPFKAAHSRNPVDRPKLFVTPPEGSARRRTIHGLASHKRERER
EHVPFHVSPGARRTLSPSNLKARSPAPARLWLPSKSMPHLPGTPRPASSLPPGSVRAASA
QAPSSSPGNIRPVKREVKVEPEKKDPLPAVKSRVPLVKVEEVTVEEGTPVKPPEPAAPAS
APIATPAPAPATDPAPVPAPSSTVTVGVVPKTSAGTTDPEEATRLLAEKRRLAREQREKE
ERERKEKEELERQKIEELARRVAEERSRREEEARRLEEEQAREKEELALRLAEEERERWE
REEVERVQKQKEEEARAREEAERARQEREKHFQKEEQERLERKKRLEEIMRRTRRTETAD
KKTTEQRNGDIAKGVLTGEPEVPALPCMASSGNGESAESPHGVALQQSEVTTESSPDLEK
QPNENGMSIQNENFEEVINLPVGSKASRLDVTNENPEIPLKPILAFNDEGTLGPLPQVDG
VQTQQTAEVI
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggcggagcagggagctggcggcgacggccacaggggcggcgacggcgctacgcacagc
gacccagcgtctgatggctataaagtacaagagaagagaactgcccccagccgccccact
tctacagtttcaggacaaactagcaaccactcaggaaacaaaccagatcccccacctgtg
ctacgggttgatgaccggcagcggctagccagagaacgccgagaggaacgagaaaaacag
ctagctgcacgagaaaccgtctggctagagagagaagaacgagcccggcagcactatgag
agacatctggaggcgaggaagaagaagctggaggaccaacggctgaaggaggagcggagg
agggctgcggtggaggagaagcggaggcagaggctggaggaggacaaggagcgccatgaa
gctgttgtccgacggacgatggaaaggagccagaagccaaggcagaagtctaaccgctgg
tcctggggaagccctctccatgggagctcgagcatccacagtggagatccagacaggcgc
tcagtttccaccatgaatctttcgaaacatgttgatcctgtcattagcaagcggctctcc
tcctcgtctgcaactttgctaaactctccagatagagctcgccgcctgcagctcagcccc
tgggagagcagcgttgttagcagacttctgacgcccacacattcgttcctggccagaagc
aaaagcacggccgccttgtctggagacacagcatcttgcagccccatcatcatgcccttc
aaagctgcacactctagaaacccagtggaccgaccaaaactctttgtaacaccgcctgag
ggctctgcacgaaggaggaccattcatggactagcgagccataaaagagagcgagaaaga
gaacacgttcccttccacgtttccccgggcgcccgcaggactctgtctccatctaatctc
aaagcgaggtcaccggctccagcccgcctttggctcccatccaagtccatgcctcatctg
cctggtactccccggcctgcatcctccttgcctcccggctcagtcagagctgcttccgct
caggccccctcctcctctcctggcaacatccggcctgtcaagagagaagtgaaagtggag
cctgagaagaaagaccctttacccgcagtaaagagcagggtgccattagtgaaggtagag
gaggtcacagtcgaagaggggacacccgtgaagccacctgagcctgctgctccagcctcg
gcccccattgcaaccccagcccctgctccagctacggacccggccccagtccctgcacca
tcatccactgtgactgtcggtgtagttcctaagacttctgcaggcaccaccgacccagag
gaggctacgaggttgctggctgagaagaggcgtctagccagagagcagagggagaaggag
gaacgggagaggaaggaaaaggaagagctggagagacaaaagatagaggaattggcccgt
agggtggctgaagagcgaagtcgcagggaagaagaagcccgcaggctggaagaggagcag
gctcgagagaaagaggagctggcgctgcgtctggctgaggaggagcgggagcggtgggag
agggaggaggtggagcgcgtgcagaagcagaaagaagaagaagcccgagcccgggaggag
gcagagagggctcggcaggaacgagagaagcatttccagaaagaagagcaggaacggctg
gagaggaagaagcgacttgaagagattatgagaagaaccaggaggacagagaccgctgat
aagaaaaccactgagcaaagaaatggtgacatagccaaaggagttctcactggagagcca
gaagtacctgcactgccgtgtatggcctcttcaggaaacggagagtctgcagagagccca
catggagtcgctttacagcaatcagaagtgaccacagagagttctccagatttggaaaaa
cagccaaatgaaaacggaatgtccatacaaaatgaaaattttgaagaagttataaactta
cctgttggatcaaaagcgtccagattagatgtcaccaatgagaacccagaaattcctttg
aaaccaattttggcctttaatgatgaagggacacttgggcccctacctcaggtggatggt
gtgcagacacaacagaccgcagaagttatatga

DBGET integrated database retrieval system