KEGG   Mus musculus (mouse): 17762
Entry
17762             CDS       T01002                                 

Gene name
Mapt, AI413597, AW045860, Mtapt, Tau
Definition
(RefSeq) microtubule-associated protein tau
  KO
K04380  microtubule-associated protein tau
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17762 (Mapt)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17762 (Mapt)
   05012 Parkinson disease
    17762 (Mapt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    17762 (Mapt)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17762 (Mapt)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17762 (Mapt)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     17762 (Mapt)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    17762 (Mapt)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     17762 (Mapt)
SSDB
Motif
Pfam: Tubulin-binding Tmemb_cc2
Other DBs
NCBI-GeneID: 17762
NCBI-ProteinID: NP_001033698
MGI: 97180
Ensembl: ENSMUSG00000018411
Vega: OTTMUSG00000003153
UniProt: P10637 Q3UH19
Structure
PDB: 
6H0E

Position
11 67.79 cM; 11 E1
AA seq 430 aa
MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKESPPQPPADDGAEEPGSETSDAKSTPT
AEDVTAPLVDERAPDKQAAAQPHTEIPEGITAEEAGIGDTPNQEDQAAGHVTQARVASKD
RTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKS
GERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMP
DLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYK
PVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKI
ETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADE
VSASLAKQGL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggctgaccctcgccaggagtttgacacaatggaagaccatgctggagattacactctg
ctccaagaccaagaaggagacatggaccatggcttaaaagagtctcccccacagcccccc
gccgatgatggagcggaggaaccagggtcggagacctccgatgctaagagcactccaact
gctgaagacgtgactgcgcccctagtggatgagagagctcccgacaagcaggccgctgcc
cagccccacacggagatcccagaaggaattacagccgaagaagcaggcatcggagacacc
ccgaaccaggaggaccaagccgctgggcatgtgactcaagctcgtgtggccagcaaagac
aggacaggaaatgacgagaagaaagccaagggcgctgatggcaaaaccggggcgaagatc
gccacacctcggggagcagcctctccggcccagaagggcacgtccaacgccaccaggatc
ccggccaagaccacgcccagccctaagactcctccagggtcaggtgaaccaccaaaatcc
ggagaacgaagcggctacagcagccccggctctcccggaacgcctggcagtcgctcgcgc
accccatccctaccaacaccgcccacccgggagcccaagaaggtggcagtggtccgcact
ccccctaagtcaccatcagctagtaagagccgcctgcagactgcccctgtgcccatgcca
gacctaaagaatgtcaggtcgaagattggctctactgagaacctgaagcaccagccagga
ggtggcaaggtgcagataattaataagaagctggatcttagcaacgtccagtccaagtgt
ggctcgaaggataatatcaaacacgtcccgggtggaggcagtgtgcaaatagtctacaag
ccggtggacctgagcaaagtgacctccaagtgtggctcgttagggaacatccatcacaag
ccaggaggtggccaggtggaagtaaaatcagagaagctggacttcaaggacagagtccag
tcgaagattggctccttggataatatcacccacgtccctggaggagggaataagaagatt
gaaacccacaagctgaccttcagggagaatgccaaagccaagacagaccatggagcagaa
attgtgtataagtcacccgtggtgtctggggacacatctccacggcacctcagcaatgtg
tcttccacgggcagcatcgacatggtggactcaccacagcttgccacactagccgatgaa
gtgtctgcttccttggccaagcagggtttgtga

DBGET integrated database retrieval system