KEGG   Mus musculus (mouse): 17763
Entry
17763             CDS       T01002                                 

Gene name
Mtcp1, P13MTCP1
Definition
(RefSeq) mature T cell proliferation 1
  KO
K16837  mature T-cell proliferation-1 type B1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    17763 (Mtcp1)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 17763
NCBI-ProteinID: NP_001034462
MGI: 102699
Ensembl: ENSMUSG00000031200
Vega: OTTMUSG00000034284
UniProt: Q60945
Position
X; X A7.3
AA seq 107 aa
MAREDVGAPPDHLWVHQEGVYRDEYQRTWVAVVEEETSFLKARVQQVQVPLGDATKPSHL
LTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcaagagaggatgtgggggctccacccgatcatctctgggttcaccaagaaggagtc
taccgcgacgaatatcagcgcacatgggtagctgtggtggaagaggagacaagtttccta
aaggctcgagtccagcaagttcaggttcctttaggtgacgcaactaagccaagtcacctt
cttacctcccaactacctctcatgtggcaactctacccagaggagcgctacatggataac
aactctcgcttgtggcagattcagcatcatttaatggtcaggggagtacaggaactactc
cttaaacttttgcctgatgattaa

KEGG   Mus musculus (mouse): 21432
Entry
21432             CDS       T01002                                 

Gene name
Tcl1, Tcl1a
Definition
(RefSeq) T cell lymphoma breakpoint 1
  KO
K10167  T-cell leukemia/lymphoma 1A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21432 (Tcl1)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 21432
NCBI-ProteinID: NP_033363
MGI: 1097166
Ensembl: ENSMUSG00000041359
Vega: OTTMUSG00000042098
UniProt: P56280
Structure
PDB: 
1JNP

Position
12 E; 12 55.28 cM
AA seq 116 aa
MATQRAHRAETPAHPNRLWIWEKHVYLDEFRRSWLPVVIKSNEKFQVILRQEDVTLGEAM
SPSQLVPYELPLMWQLYPKDRYRSCDSMYWQILYHIKFRDVEDMLLELIDSESNDE
NT seq 351 nt   +upstreamnt  +downstreamnt
atggctacccagcgggcacacagggcagagacacctgcacaccccaaccgcctgtggatc
tgggagaagcacgtgtacttggatgagtttcgtcgaagctggctgcccgtagtcatcaag
agtaatgaaaaattccaggtgatcttgcgccaggaagatgtcaccttgggggaagctatg
tcccccagtcagctggtgccttacgagctgcctttaatgtggcaactgtaccccaaggac
aggtaccgaagctgcgactccatgtattggcagatcctgtaccatatcaagtttagagac
gtggaggacatgttgcttgaactgatagactcggagtccaacgatgaataa

KEGG   Mus musculus (mouse): 27379
Entry
27379             CDS       T01002                                 

Gene name
Tcl1b1, C88214
Definition
(RefSeq) T cell leukemia/lymphoma 1B, 1
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    27379 (Tcl1b1)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 27379
NCBI-ProteinID: NP_038801
MGI: 1351601
Ensembl: ENSMUSG00000066359
UniProt: P56840 Q3UWQ4
Position
12; 12 E
AA seq 116 aa
MAAAAFDPLGPLPVYLVSVRLGIYEDEHHRVWIVANVETSHSSHGNRRRTHVTVHLWKLI
PQQVIPFNPLNYDFLPTTWKLESRNIYWATDGTHWRLLDHSQLGDTEQLILMLVLG
NT seq 351 nt   +upstreamnt  +downstreamnt
atggctgctgcagcttttgatcccctggggccacttccagtctacctggtctccgttaga
ctgggcatctatgaggatgaacatcatagagtgtggatagttgcaaatgtggaaacttct
cactcatcacatggcaacaggaggagaacccatgtaactgtccacttgtggaagttaatc
ccccagcaggttattcccttcaaccccttgaattacgactttctacccacgacgtggaaa
ttagagtccaggaacatatactgggcaacagatgggactcactggagattactggatcat
tcccagttgggtgacacagagcaactgatcctgatgctggtgttagggtga

KEGG   Mus musculus (mouse): 27380
Entry
27380             CDS       T01002                                 

Gene name
Tcl1b4, AA675342
Definition
(RefSeq) T cell leukemia/lymphoma 1B, 4
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    27380 (Tcl1b4)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 27380
NCBI-ProteinID: NP_038802
MGI: 1351604
Ensembl: ENSMUSG00000079007
UniProt: P56844
Position
12; 12 E
AA seq 120 aa
MADSVRFPCMPFPPCFLVCTRDDIYEDEHGRQWVAAKVETSSHSPYCSKIETCVTVHLWQ
MTTLFQEPSPDSLKTFNFLPRTWRLESRNTYRGADAMHWRLVNHSQFYGTEELVLMLDSR
NT seq 363 nt   +upstreamnt  +downstreamnt
atggctgattcagttcgttttccctgtatgccattcccaccttgcttcctggtctgcaca
agagatgacatctatgaggatgaacatggtagacagtgggtagctgcaaaagtggaaact
tcttctcattcaccatattgcagcaagattgaaacctgtgtaactgtccacttgtggcag
atgaccacactcttccaggagcctagtcccgactctctcaagactttcaactttctaccc
aggacatggagattagagtccaggaacacataccggggagcagatgccatgcactggaga
ttagtgaatcattcccagttttatggcacagaggaactggtcctgatgctggattcaagg
taa

KEGG   Mus musculus (mouse): 27381
Entry
27381             CDS       T01002                                 

Gene name
Tcl1b2
Definition
(RefSeq) T cell leukemia/lymphoma 1B, 2
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    27381 (Tcl1b2)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 27381
NCBI-ProteinID: NP_038803
MGI: 1351609
Ensembl: ENSMUSG00000060863
Vega: OTTMUSG00000033067
UniProt: P56841 Q4FZI4
Position
12; 12 E
AA seq 117 aa
MAAAGFYPPRLLPQVLISTGPGFYEDEHHRLWMVAKLETCSHSPYCNKIETCVTVHLWQM
TRYPQEPAPYNPMNYNFLPMTWRLASMNTYRGTDAMHWRLLNHSQVGDTVQLILMLE
NT seq 354 nt   +upstreamnt  +downstreamnt
atggctgctgcaggtttttatcctccgaggctactcccacaagttctgatctccacagga
ccgggcttctatgaggatgaacatcatagactgtggatggttgcaaaactggaaacttgt
tctcattcaccatattgcaacaagattgaaacatgtgtaactgttcacttgtggcagatg
accagatacccccaggagcctgctccctacaatcccatgaattacaactttctacccatg
acgtggagattagcatccatgaacacataccggggaacagatgccatgcactggagatta
ctgaatcattcccaggttggtgacacagtgcaactgatcctgatgctggagtaa

DBGET integrated database retrieval system