KEGG   Mus musculus (mouse): 17772Help
Entry
17772             CDS       T01002                                 

Gene name
Mtm1, AF073996, Mtm, mKIAA4176
Definition
(RefSeq) X-linked myotubular myopathy gene 1
  KO
K01108  myotubularin [EC:3.1.3.64 3.1.3.95]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    17772 (Mtm1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    17772 (Mtm1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    17772 (Mtm1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     17772 (Mtm1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     17772 (Mtm1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    17772 (Mtm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase 3-PAP Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 17772
NCBI-ProteinID: NP_001157662
MGI: 1099452
Ensembl: ENSMUSG00000031337
Vega: OTTMUSG00000017829
UniProt: Q9Z2C5 Q9D4L1
Position
X A7.3; X 36.55 cM
AA seq 603 aa AA seqDB search
MASASASKYNSHSLENESIKKVSQDGVSQDVSETVPRLPGELLITEKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLR
FALKQEGHSRRDMFEILVKHAFPLAHNLPLFAFVNEEKFNVDGWTVYNPVEEYRRQGLPN
HHWRISFINKCYELCETYPALLVVPYRTSDDDLRRIATFRSRNRLPVLSWIHPENKMVIM
RCSQPLVGMSGKRNKDDEKYLDVIRETNKQTSKLMIYDARPSVNAVANKATGGGYESDDA
YQNSELSFLDIHNIHVMRESLKKVKDIVYPNIEESHWLSSLESTHWLEHIKLVLTGAIQV
ADQVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRTIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNEGFLITVLDHLYSCRFGTFLF
NCDSARERQKLTERTVSLWSLINSNKDKFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRVKQQQPNPVEQRYMELLALRDDYIKRLEELQLANSAKLADAPASTSSSSQMVPHVQ
THF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgcatcagcatctaagtataattcacactccttggagaatgaatccattaag
aaagtgtctcaagatggagtcagtcaggatgtgagtgagactgtccctcggctcccaggg
gagttactaattactgaaaaagaagttatttacatatgtcctttcaatggccccattaag
ggaagagtttacatcacaaattatcgtctttatttaagaagtttggaaacggattctgct
ctaatacttgatgttcctctgggtgtgatatcaagaattgaaaaaatgggaggcgcgaca
agtagaggagaaaattcctatggtctagatattacttgtaaagatttgagaaacctgagg
tttgcattgaagcaagaaggccacagcagaagagatatgtttgagatccttgtaaaacat
gcctttcctctggcacacaatctgccattatttgcatttgtaaatgaagagaagtttaac
gtggatgggtggactgtttataatccagttgaagaatatagaaggcagggcctgcccaat
caccattggaggataagttttattaacaagtgctatgagctctgtgagacataccctgct
cttttggtggttccctatcggacctcagatgatgatcttaggaggatcgcaacgtttaga
tcccgaaatcggcttcctgtactgtcgtggattcacccagaaaacaaaatggtcattatg
cgctgcagtcagcctcttgtcggtatgagtggtaaaagaaataaagatgacgagaaatac
ctggatgtgatcagggaaactaacaaacaaacttctaagctcatgatttatgatgcacga
cccagtgtaaatgcagtcgccaacaaggcaacaggaggaggatatgaaagtgatgacgca
tatcaaaactcagaactttccttcttagacattcataatattcatgttatgcgagaatct
ttaaaaaaagtgaaagatattgtttatcccaacatagaagaatctcattggttgtccagt
ttggagtctactcattggttagaacatatcaagcttgttctgaccggtgccattcaagtg
gcagaccaagtgtcttcaggaaagagctcggtacttgtgcactgcagtgacggatgggac
aggaccgctcagctgacatccttggccatgctgatgttggacagcttctacagaactatt
gaaggctttgagatattggtacagaaagagtggataagttttggccataaatttgcatct
agaataggtcatggtgataaaaaccatgctgatgctgatcgatctcctatttttcttcag
tttattgactgtgtgtggcagatgtcgaaacagttccccacagcttttgagttcaatgaa
ggctttttgattaccgttttggatcatctgtatagctgtcgatttggtactttcttattc
aactgtgactcggctcgagaaagacagaaacttacagaaagaacagtttctctatggtcg
ctaattaacagcaataaagacaaattcaaaaaccccttctatacaaaagaaatcaatcgg
gttttgtatccagttgccagcatgcgtcacttggaactgtgggtgaattattacatccga
tggaatcccagggtcaagcagcaacagcccaacccagtggagcagcgttacatggagctt
ttggccttgcgtgacgattatataaagaggctcgaggaattgcagctggccaactccgcc
aagcttgctgatgcccccgcttcgacttccagttcgtcacagatggtgccccatgtgcag
acgcacttctga

DBGET integrated database retrieval system