KEGG   Mus musculus (mouse): 17826Help
Entry
17826             CDS       T01002                                 

Gene name
Fam89b, 1110021A21Rik, MMTV, Mtvr2
Definition
(RefSeq) family with sequence similarity 89, member B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LURAP
Motif
Other DBs
NCBI-GeneID: 17826
NCBI-ProteinID: NP_852117
MGI: 106595
Ensembl: ENSMUSG00000024939
Vega: OTTMUSG00000035064
UniProt: Q9QUI1 Q7TMI7
Position
19 A; 19 4.34 cM
AA seq 189 aa AA seqDB search
MNGLPATEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAAR
APDGPRHAAGSANSGSAAGPRRPVNLDSALAALRKEMVGLRQLDMSLLCQLWGLYESIQD
YKHLCQDLSLCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNARDQW
LQDAFQISL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggctgcccgcgactgaggcgccgggcggcgcgggctgcgctctggccgggctc
ccgccgctaccgcgcggcctcagcggccttcttaacgctagtgggggctcgtggagggag
ctggagcgtgtctacagccaacggagccgcatccacgacgaactgagtcgtgccgcccgc
gccccggatggtcctcgccatgccgctggatctgctaactcaggttctgcagcgggcccg
cgccgcccggttaacctcgactctgcactagccgcgctgcgcaaggagatggtggggctg
cgacagctggatatgtccctgttgtgccagctgtggggcctgtacgagtcgatccaggac
tacaagcatctgtgccaagacctgagcttgtgccaggacctgtcatcctctctgcactcg
gacagctcctacccacctgatgccggcctgtctgatgacgaggagcctcctgatgccagc
ctgcccccagaccctccacccctcaccgtaccccagactcacaatgcccgtgaccagtgg
ttgcaggatgctttccaaatcagcctttga

DBGET integrated database retrieval system