KEGG   Mus musculus (mouse): 17840Help
Entry
17840             CDS       T01002                                 

Gene name
Mup1, Ltn-1, Lvtn-1, Mup-1, Mup-a, Mup10, Mup7, Up-1
Definition
(RefSeq) major urinary protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin ELH
Motif
Other DBs
NCBI-GeneID: 17840
NCBI-ProteinID: NP_001156482
MGI: 97233
Ensembl: ENSMUSG00000078683
Vega: OTTMUSG00000007426
UniProt: A2CEL1
Position
4 B3; 4 32.85 cM
AA seq 180 aa AA seqDB search
MKMLLLLCVGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL
EQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLM
AHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgctgctgctgctgtgtgtgggactgaccctagtctgtgtccatgcagaagaa
gctagttctacgggaaggaactttaatgtagaaaagattaatggggaatggcatactatt
atcctggcctctgacaaaagagaaaagatagaagataatggcaactttagactttttctg
gagcaaatccatgtcttggagaattccttagttcttaaattccatactgtaagagatgaa
gagtgctcggaattatctatggttgctgacaaaacagaaaaggctggtgaatattctgtg
acgtatgatggattcaatacatttactatacctaagacagactatgataactttcttatg
gctcatctcattaacgaaaaggatggggaaaccttccagctgatggggctctatggccga
gaaccagatttgagttcagacatcaaggaaaggtttgcacaactatgtgagaagcatgga
atccttagagaaaatatcattgacctatccaatgccaatcgctgcctccaggcccgagaa
tga

DBGET integrated database retrieval system