KEGG   Mus musculus (mouse): 17863
Entry
17863             CDS       T01002                                 

Gene name
Myb, AI550390, M16449, c-myb
Definition
(RefSeq) myeloblastosis oncogene
  KO
K09420  transcriptional activator Myb
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    17863 (Myb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17863 (Myb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    17863 (Myb)
SSDB
Motif
Pfam: Cmyb_C Myb_DNA-binding Myb_DNA-bind_6 LMSTEN Myb_DNA-bind_7 SANT_DAMP1_like Spore_III_AB
Other DBs
NCBI-GeneID: 17863
NCBI-ProteinID: NP_034978
MGI: 97249
Ensembl: ENSMUSG00000019982
Vega: OTTMUSG00000046559
UniProt: P06876 Q3UUX5
Structure
PDB: 

Position
10 A3; 10 9.75 cM
AA seq 636 aa
MARRPRHSIYSSDEDDEDIEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQEPSKASQTPVATSFQKNNHLMGFGHASPPSQLSPSGQSSV
NSEYPYYHIAEAQNISSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQALPTQNHTCSYPGWHSTSIVDQTRPHGDSAPVSCLGEHHATPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHESSGLDAPTLP
STPLIGHKLTPCRDQTVKTQKENSIFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPL
KMLPQTPSHAVEDLQDVIKQESDESGIVAEFQESGPPLLKKIKQEVESPTEKSGNFFCSN
HWAENSLSTQLFSQASPVADAPNILTSSVLMTPVSEDEDNVLKAFTVPKNRPLVGPLQPC
SGAWEPASCGKTEDQMTASGPARKYVNAFSARTLVM
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggcccggagaccccgacacagcatctacagtagcgatgaagatgatgaagacattgag
atgtgtgaccatgactacgatgggctgctgcccaaatctggaaagcgtcacttggggaaa
actaggtggacaagggaagaggatgagaagctgaagaagctggtggaacagaacggaaca
gacgactggaaagtcattgccaattatctgcccaaccggacagatgtgcagtgccaacac
cggtggcagaaagtgctgaaccctgaactcatcaaaggtccctggaccaaagaagaagat
cagagagtcatagagcttgtccagaaatatggtccgaagcgttggtctgttattgccaag
cacttaaaagggagaattggaaagcagtgtcgggagaggtggcacaaccatttgaatcca
gaagttaagaaaacctcctggacagaagaggaggacagaatcatttaccaggcacacaag
cgtctggggaacagatgggcagagatcgcaaagctgctgcccggacggactgataatgct
atcaagaaccactggaattccaccatgcgtcgcaaggtggaacaggaaggctacctgcag
gagccttccaaagccagccagacgccagtggccacgagcttccagaagaacaatcatttg
atggggtttgggcatgcctcacctccatctcagctctctccaagtggccagtcctccgtc
aacagcgaatatccctattaccacatcgccgaagcacaaaacatctccagtcacgttccc
tatcctgtcgcattgcatgttaatatagtcaacgtccctcagccggctgcggcagccatc
cagagacactataacgacgaagaccctgagaaggaaaagcgaataaaggagctggagttg
ctcctgatgtcaacagagaacgagctgaagggacagcaggcattaccaacacagaaccac
acttgcagctaccccgggtggcacagcacctccattgtggaccagaccagacctcatggg
gatagtgcacctgtttcctgtttgggagaacaccatgccaccccatctctgcctgcagat
cccggctccctacctgaagaaagtgcctcaccagcaaggtgcatgatcgtccaccagggc
accattctggacaatgttaagaacctcttagaatttgcagaaacactccagtttatagat
tctttcttgaacacttccagcaaccatgaaagctcgggcttagatgcacctaccttaccc
tccactcctctcattggtcacaaactgacaccatgtcgagaccagactgtgaaaacccag
aaggaaaattccatctttagaactccagctatcaaaaggtcaatcctcgaaagctctcct
cgaactcccacaccattcaaacatgcccttgcagctcaagaaattaaatacggtcccctg
aagatgctacctcagaccccctcccatgcagtggaggacctacaagatgtgattaagcag
gaatcggatgaatctggaattgtggctgagtttcaagagagtggaccaccgttactgaaa
aaaatcaagcaggaggtggagtcgccaactgagaaatcgggaaacttcttctgctcaaac
cactgggcagagaacagcctgagcacccagctgttctcgcaggcgtctcctgtggcagat
gccccaaatattcttacaagctctgttttaatgacacctgtatcagaagatgaagacaat
gtcctcaaagcctttaccgtacctaagaacaggcccctggtgggtcccttgcagccatgc
agtggtgcctgggagccagcatcctgtgggaagacagaggaccagatgacggcctccggt
ccggctcggaaatacgtgaacgcgttctcagctcgaactctggtcatgtga

DBGET integrated database retrieval system