KEGG   Mus musculus (mouse): 17874Help
Entry
17874             CDS       T01002                                 

Gene name
Myd88
Definition
(RefSeq) myeloid differentiation primary response gene 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex infection
Module
mmu_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17874 (Myd88)
   04064 NF-kappa B signaling pathway
    17874 (Myd88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    17874 (Myd88)
   04621 NOD-like receptor signaling pathway
    17874 (Myd88)
 09160 Human Diseases
  09167 Infectious diseases
   05132 Salmonella infection
    17874 (Myd88)
   05133 Pertussis
    17874 (Myd88)
   05134 Legionellosis
    17874 (Myd88)
   05152 Tuberculosis
    17874 (Myd88)
   05162 Measles
    17874 (Myd88)
   05164 Influenza A
    17874 (Myd88)
   05161 Hepatitis B
    17874 (Myd88)
   05168 Herpes simplex infection
    17874 (Myd88)
   05144 Malaria
    17874 (Myd88)
   05145 Toxoplasmosis
    17874 (Myd88)
   05140 Leishmaniasis
    17874 (Myd88)
   05142 Chagas disease (American trypanosomiasis)
    17874 (Myd88)
   05143 African trypanosomiasis
    17874 (Myd88)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TIR TIR_2
Motif
Other DBs
NCBI-GeneID: 17874
NCBI-ProteinID: NP_034981
MGI: 108005
Ensembl: ENSMUSG00000032508
Vega: OTTMUSG00000016655
UniProt: P22366 Q3U7M4
Position
9 F3; 9 71.33 cM
AA seq 296 aa AA seqDB search
MSAGDPRVGSGSLDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLE
IRELETRPDPTRSLLDAWQGRSGASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQ
QNQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIR
QLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgggagacccccgcgtgggatccgggtccctggactccttcatgttctccata
cccttggtcgcgcttaacgtgggagtgaggcgccgcctatcgctgttcttgaaccctcgg
acgcccgtggcggccgactggaccttgctggcggaggagatgggcttcgagtacttggag
atccgagagctggaaacgcgccctgaccccactcgcagtttgttggatgcctggcagggg
cgctctggcgcgtctgtcggcaggctgctagagctgctggccttgttagaccgtgaggat
atactgaaggagctgaagtcgcgcatcgaggaggactgccagaaatacttaggtaagcag
cagaaccaggagtccgagaagcctttacaggtggccagagtggaaagcagtgtcccacaa
acaaaggaactgggaggcatcaccacccttgatgaccccctaggacaaacgccggaactt
ttcgatgcctttatctgctactgccccaacgatatcgagtttgtgcaggagatgatccgg
caactagaacagacagactatcggcttaagttgtgtgtgtccgaccgtgacgtcctgccg
ggcacctgtgtctggtccattgccagcgagctaattgagaaaaggtgtcgccgcatggtg
gtggttgtttctgacgattatctacagagcaaggaatgtgacttccagaccaagtttgca
ctcagcctgtctccaggtgtccaacagaagcgactgattcctattaaatacaaggcgatg
aagaaggactttcccagtatcctgcggttcatcactatatgcgactataccaacccttgc
accaagtcctggttctggacccgccttgccaaggctttgtccctgccctga

DBGET integrated database retrieval system