KEGG   Mus musculus (mouse): 17885Help
Entry
17885             CDS       T01002                                 

Gene name
Myh8, 4832426G23Rik, AI327267, MHCp, MyHC-pn, Myhs-p, Myhsp
Definition
(RefSeq) myosin, heavy polypeptide 8, skeletal muscle, perinatal
  KO
K10352  myosin heavy chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    17885 (Myh8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17885 (Myh8)
   04147 Exosome [BR:mmu04147]
    17885 (Myh8)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17885 (Myh8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   17885 (Myh8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N IQ AAA_22 AAA_16
Motif
Other DBs
NCBI-GeneID: 17885
NCBI-ProteinID: NP_796343
MGI: 1339712
Ensembl: ENSMUSG00000055775
Vega: OTTMUSG00000005922
UniProt: P13542
Position
11 B3; 11 40.59 cM
AA seq 1937 aa AA seqDB search
MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSVIQSKDGG
KVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTY
SGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILIT
GESGAGKTVNTKRVIQYFATIAVTGDKKKEESGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPEL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFSPEEKVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQCLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSNNFQKPKPTKGKAEAHFSLVHYAGTVDYNITGWLDKN
KDPLNDTVVGLYQKSAMKTLASLFSTYASAEADGGAKKGAKKKGSSFQTVSALFRENLNK
LMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGD
FKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEMR
DEKLAQIITRTQAVCRGYLMRVEYQKMLLRRESIFCIQYNVRAFMNVKHWPWMKLFFKIK
PLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADS
LADAEERCEQLIKNKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDL
ELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLTKEKKALQEAHQQTLDDLQAEEDKV
NTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLD
EKLKKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRS
DLSRELEEISERLEEAGGATSAQVEMNKKRETEFQKLRRDLEEATLQHEATAAALRKKHA
DSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLSSNAEAIAKAKGNLEKMCRTLEDQVS
ELKSKEEEQQRLINELTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKR
QLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYET
DAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNA
ACAALDKKQRNFDKVLSEWRQKYEETQAELESCQKESRTLSTELFKVKNAYEESLDHLET
LRRENKNLQQEISDLTEQIAEGGKHIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGK
ILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHVRVVETMQSTLDAEIRSRNDALRVKKK
MEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKDTQLHLDDALRGQEDLKEQLAIVERR
ANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQL
QSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRL
DEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEED
RKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLAKFRKLQHELEEAEERADIAESQV
NKLRVKSREVHTKISAE
NT seq 5814 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgggttcggacgcggagatggctatttttggcgaagctgctccttacctccga
aaatcggagaaggagaggattgaggcccaaaataagccttttgacgcaaaaacatctgtc
tttgtggcggagcccaaggagtcttatgtgaaaagcgttatacaaagcaaggatggaggg
aaagtgaccgtgaagacggaaagtggagcaactctcaccgtcaaggaagatcaagtcttc
cccatgaaccctcccaaatatgacaagatcgaggacatggccatgatgacccacctccat
gagcccggagtgctgtacaacctcaaagagcgttatgcagcctggatgatctatacctac
tcaggcctcttctgtgtcaccgtcaacccctacaagtggctgccggtgtacaaccctgag
gtggtggcagcctaccgaggcaaaaagcgccaggaggccccaccccacatcttctccatc
tctgacaacgcctaccagttcatgctgacggatcgtgagaaccagtccatcctgatcacc
ggagaatccggggccgggaagactgtgaacacgaagcgtgtcatccagtactttgcaaca
attgcagtcactggggacaagaagaaggaggagtctggcaaaatgcaggggaccctggaa
gatcaaatcatcagtgctaaccccctgctggaggcctttgggaacgccaagaccgtgagg
aatgacaactcatctcgctttggcaagttcatcagaatccacttcggtaccacggggaaa
ctggcatcagctgatattgaaacctatcttctagagaagtctagagtcactttccagcta
aaagctgaaagaagttaccacattttttatcagatcacctccaataagaagccagagcta
attgaaatgctcctgatcaccaccaacccgtatgactacgcctttgtcagtcagggggag
atcacggtgcccagcattgatgaccaagaagagttgatggccacagatagtgccattgat
atccttggcttttcacctgaagagaaagtgtccatctataaactcacaggggctgtgatg
cattatgggaacatgaagttcaagcaaaagcagcgggaggagcaggctgagccagatggc
actgaagtggctgacaaggctgcctatctccagtgtctgaactctgctgatctgctcaaa
gccctctgctatcccagggtcaaggttggcaatgaatatgtcaccaaaggccagacggtt
caacaagtgtataatgcggtgggtgccctggccaaggctgtctatgagaagatgttcctg
tggatggtcacccgcatcaaccagcagctggacaccaagcagccccggcagtacttcatc
ggggtcttggacatcgctggctttgagatctttgatttcaacagcctggagcagctgtgc
atcaacttcaccaatgagaaactgcaacagtttttcaaccaccacatgttcgtgctggag
caggaggagtacaagaaggaaggcatcgagtggaccttcatcgacttcgggatggacctg
gcggcctgcatcgagctcattgagaagccactgggcatcttctccatcctggaagaagag
tgcatgttccctaaggcgacagacacctccttcaagaacaagctgtacgaccaacatctg
ggaaaatccaacaacttccagaagcccaagcctaccaaaggcaaggccgaggcccacttc
tccctggtgcactatgcgggcactgtggattacaacatcaccggctggctggacaagaac
aaggaccccctgaatgacaccgtggtggggctgtaccagaagtcagcaatgaaaactctg
gccagcctcttttccacatacgctagtgctgaagcagatggtggtgcaaagaaaggagct
aagaagaagggctcttctttccaaactgtgtcagcccttttcagggaaaacttaaataaa
ctgatgaccaatctgagaagtacacaccctcacttcgtacggtgtatcattcccaatgaa
acgaagactcccggtgccatggagcacgaactggtcctgcaccagctgaggtgtaacggg
gtgctggagggcatccgcatctgcaggaaggggttccccagccggatcctgtatggggac
tttaagcagagatacaaggttttaaatgcaagtgctattccagagggacagttcatcgac
agcaagaaggcctctgagaagcttctgggctctattgatatcgatcacactcagtataaa
tttggacacaccaaggttttcttcaaagctggtctcctgggtctcctggaagaaatgaga
gatgaaaagctggcccagattataacaagaacccaggcggtctgtaggggatacctaatg
agagtggagtatcagaagatgctgctgagaagagaatccatcttctgtatccagtacaac
gtccgcgccttcatgaacgtcaagcactggccctggatgaaactcttcttcaagatcaaa
cccctgctgaagagcgcagagaccgagaaggagatggccaccatgaaggaggagttccag
aaaaccaaggatgagctggccaagtcggaggcaaagcggaaggagctggaggagaagatg
gtcactcttctcaaagagaaaaatgacctgcaactccaggttcaatctgaagcagacagc
ttggccgatgctgaggaaaggtgtgaacaattgatcaaaaacaaaatccagctggaggcc
aaaatcaaagaggtgaccgagagggccgaggacgaggaggagatcaacgcggagctcacg
gccaagaagaggaagctggaggacgagtgctcagagctgaagaaggacatcgatgacctt
gagctgacactggccaaggttgagaaggagaagcacgccacggagaacaaggtgaaaaac
ctgacagaggagatggcaggcctggatgaaaatatcgccaagctgaccaaggagaagaag
gccctccaggaggcccaccagcagaccctggatgacctgcaggcagaggaggacaaagtc
aacaccctgaccaaagccaaaaccaagctggaacagcaagtggatgaccttgagggatcg
ctagagcaagaaaagaagctgaggatggacttagaaagagccaagaggaaactggagggg
gacctgaaactggcccaagagtccacaatggacatagaaaacgataaacagcagcttgat
gagaaactcaaaaagaaggagtttgaaatcagcaacctgataagcaaaattgaagatgag
caagctgtggagatccagctgcagaagaagatcaaagagttgcaggcccgcatcgaggag
ctggaggaggaaatcgaggcagagcgggcctccagggccaaagcagagaagcagcgctct
gacctctcccgggaactggaggagatcagcgagaggctggaagaagccggcggggccacc
tctgctcaggtggagatgaacaagaagcgggaaactgagtttcagaaacttcgccgggac
ctggaggaggccacgctgcagcacgaagccacagcagccgctcttcggaagaagcacgcg
gacagtgtggctgagctcggggagcagatcgacaacctgcagcgggtgaagcagaagctg
gagaaggagaagagcgagctgaagatggagatcgatgaccttagcagtaatgcagaggcc
atcgccaaagccaagggaaatctggagaagatgtgccgcactctggaggaccaggtgagt
gaactgaagagcaaggaggaggagcagcagcggctcatcaacgagctgacagcgcagaga
gcacgcctgcagacagaagcaggtgagtactccagacagctggatgagaaagatgcttta
gtctctcagttgtcaaggagcaagcaggcatccacgcagcagattgaggagctgaagcgt
cagctcgaggaagaaaccaaggccaagaacgcgctggcccacgccctgcagtcctcccgc
cacgactgtgatctgctgcgggaacagtatgaagaggagcaggaaggcaaagccgagctg
cagagggcactgtccaaggccaacagcgaggtggcccagtggaggaccaaatatgagacc
gatgccatccagcgcacagaggagctggaggaggccaagaagaagctggctcagcgtctg
caggcggccgaggagcacgtagaagccgtgaacgccaagtgcgcttccctggagaagacg
aagcagcggctgcagaacgaggtggaggacctcatgattgatgtggagaggaccaacgcg
gcctgcgccgccctggacaagaagcagagaaacttcgacaaggttctatcagaatggaga
cagaagtatgaggaaactcaggctgagcttgagtcctgccagaaggagtcccgaactctc
agcacggagctgttcaaggtgaagaacgcctacgaggagtctctggaccacctggagacg
ctgaggagagagaacaagaatctgcaacaggagatctctgacctgactgagcagattgca
gagggagggaagcacatccatgagctggagaaaatcaagaagcaagtggaacaggagaag
tgtgagatacaggctgccttagaggaagcagaggcatctctggagcacgaggagggaaag
atcctgcgcatccagctggagctgaaccaagtcaagtctgagatcgacaggaagattgct
gagaaggatgaggagatcgaccagctgaagaggaaccacgttagagtcgtggagaccatg
cagagcacgctggatgccgagatcaggagcaggaatgatgctctgagagtcaagaagaag
atggagggagacctgaacgagatggagatccagctgaaccacgccaaccgcttggctgct
gaaagtttgaggaactacaggaacacacagggcatcctcaaggacacccagctgcatctg
gatgacgctctccggggccaggaggatctgaaggagcagctggccatcgtggagcgcaga
gccaacctgctgcaggctgagattgaggagctgcgggccacgctggagcagacggagagg
agcaggaagattgcagagcaggagctgctggacgccagtgagcgcgtgcagctcctccac
acccagaacacgagcctcatcaacaccaagaagaagctggaaaatgatgtttcacagctg
cagagtgaagtggaagaagtgattcaagagtcacgcaatgcagaagagaaggctaagaaa
gccattactgatgccgccatgatggcggaggagctgaagaaggagcaggacaccagcgcc
cacctggagcggatgaagaagaacatggaacagacggtgaaggacctgcagcaccgtctg
gacgaggctgagcagctggcgctgaagggcggcaagaagcagatccagaaactggaggcc
agggtacgtgaacttgaaggagaggtcgaaaatgaacagaaacgcaatgctgaggctgtt
aaagggttaaggaagcatgaaagaagagtaaaggaacttacctaccagactgaggaagac
cgcaagaatgtgctccggctgcaggacctggtggacaaattacaggcgaaggtgaaatcc
tacaagagacaggctgaggaggctgaggaacaatccaatgccaacctggccaagttccgc
aagctgcagcacgagctggaggaagccgaggagcgggctgacatcgccgagtcccaggtc
aacaagctgcgggtgaagagccgggaggttcacaccaaaatcagcgcagagtaa

DBGET integrated database retrieval system