KEGG   Mus musculus (mouse): 17886
Entry
17886             CDS       T01002                                 

Gene name
Myh9, Fl, Fltn, Myhn, Myhn-, Myhn-1, Myhn1, NMHCIIA, NMMHC-A, NMMHC-IIA, TU72.6
Definition
(RefSeq) myosin, heavy polypeptide 9, non-muscle
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04530  Tight junction
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    17886 (Myh9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17886 (Myh9)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    17886 (Myh9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17886 (Myh9)
   04147 Exosome [BR:mmu04147]
    17886 (Myh9)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17886 (Myh9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   17886 (Myh9)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Crescentin CC2-LZ IQ ADIP AAA_22
Other DBs
NCBI-GeneID: 17886
NCBI-ProteinID: NP_071855
MGI: 107717
Ensembl: ENSMUSG00000022443
Vega: OTTMUSG00000016428
UniProt: Q8VDD5
Position
15 E1; 15 36.81 cM
AA seq 1960 aa
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSSKNGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQLGNIAFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLRLRNWQWWRLFTKVKPLLNS
IRHEDELLAKEAELTKVREKHLAAENRLTEMETMQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQYLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRVAEFTTNLMEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELETQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEE
LADQLEQTKRVKATLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQVK
FSEGERVRTELADKVTKLQVELDSVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQVTDMKKKMEDGVGCL
ETAEEAKRRLQKDLEGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAMAARKKLEMDLK
DLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKAKLQEMESA
VKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRTEKKLKDVLLQVEDERRNAEQ
FKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVTRRIVRKGTGDCSDEEVDGKADGADAKAAE
NT seq 5883 nt   +upstreamnt  +downstreamnt
atggctcagcaggctgcagacaagtacctctatgtggataaaaacttcatcaataacccg
ctggcccaagctgactgggctgccaagaagttggtatgggtgccttccagcaagaatggc
tttgaaccagctagcctcaaggaggaggtgggagaagaggccattgtagagctggtagag
aatgggaagaaggtgaaggtgaacaaggacgacatccagaagatgaacccacccaagttc
tccaaggtggaggacatggcagagctcacgtgcctcaacgaagcttcggtgctgcacaac
ctcaaggagcgatactactcagggcttatctacacctattcaggcctgttctgtgtggtc
atcaacccttataagaacctgcccatctactcagaggagatcgtggagatgtacaagggc
aagaagaggcacgagatgccaccccacatctacgccatcacagatactgcctaccggagc
atgatgcaggaccgggaagatcagtccatcctgtgcacgggggagtctggagcagggaag
acagagaacaccaagaaagtcatccagtacctggcacatgtggcctcctcacacaagagc
aagaaggaccagggggagttggagcggcagctgctacaggccaaccctatcctagaggcc
tttggaaacgccaagacggtgaagaatgacaactcctctcgattcggtaaattcattcgt
atcaactttgatgtcaatggctacattgttggtgccaacattgagacttatcttctggag
aaatctcgtgctatccgccaagccaaagaggagcggaccttccacatcttctactacctg
ctgtctggggccggagaacacctgaagactgatctcctgttggagccatacaacaaatac
cgcttcctgtccaacgggcacgtcaccatccctgggcagcaggacaaggacatgttccag
gagacaatggaggccatgagaattatgggcatcccagaggatgagcagatgggcttgctg
cgggtcatctctggggtccttcagcttggcaacattgccttcaagaaggagcggaacact
gaccaggcgtccatgccggacaacacagctgctcaaaaggtgtcccacctcctggggatc
aatgtgaccgacttcaccagaggcatcctcaccccacgcatcaaggtgggcagagactat
gtgcagaaggcgcagactaaagagcaggctgactttgccattgaggccttggccaaggct
acctatgagcggatgttccgctggctggtgcttcgcatcaacaaagctctggacaagacc
aagaggcagggcgcctcatttatcgggatcctggacatcgctggctttgagatctttgat
ctgaactccttcgagcagctgtgcatcaactacaccaacgagaagctgcagcagctgttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgagagggcatcgagtggaac
ttcatcgacttcggcctggacctgcagccctgcatcgacctcattgagaagccggcgggt
cccccaggcatcctggccctgctagatgaggagtgctggtttcctaaggccactgacaag
agcttcgtggagaaggtggtgcaggagcagggcacccaccccaagttccagaagcccaag
caactgaaggacaaggctgatttctgcattatccactatgccggcaaggtggactataaa
gctgacgagtggctgatgaagaacatggaccccttgaacgacaacatcgccacgctgctt
caccagtcctcagacaagtttgtctctgagctgtggaaggatgtggatcggatcattggc
ttggaccaagtggctggaatgtccgagacagcactacctggtgccttcaagacccggaag
ggcatgttccgtactgtcggacagctgtacaaggagcagctggccaagctcatggccacg
ttgaggaataccaaccccaacttcgtgcgctgcatcattcccaaccatgagaagaaggcc
ggcaaactggacccgcacttggtgctggaccagctgcgctgcaatggcgtccttgagggc
atccggatctgccgccagggctttcccaacagggtggtcttccaggagttccggcagagg
tatgagatcctcacccccaactccatcccgaagggcttcatggatggcaagcaagcgtgt
gtgctcatgatcaaagccttggagcttgacagcaacctgtaccgcatcggccagagcaaa
gtgttcttccgggcaggagtgctagcccacctggaggaagagcgggacctgaagatcacc
gatgtcatcattggcttccaggcctgctgcaggggctacctggccaggaaggcctttgcc
aagaggcagcaacagctgaccgccatgaaggtcctacagaggaactgtgctgcgtacctc
aggctgcgcaactggcagtggtggaggctcttcaccaaggtcaagcccctgttgaactca
ataagacatgaggatgagctgttagccaaggaggcggaactgacaaaggttcgagagaaa
catctggctgcagagaacaggctgacagagatggagacgatgcagtctcagctcatggca
gagaagctgcagcttcaggagcagctgcaggcggagacagagctgtgtgccgaggctgag
gagctccgggcccgtctgacagcgaagaagcaggagctggaggagatctgccatgacctg
gaggccagggtggaggaggaggaggagcgctgccagtacctgcaggccgagaagaagaag
atgcagcagaacatccaggaacttgaggagcagttggaggaggaggagagcgcccggcag
aagctgcagcttgagaaggtgaccaccgaggccaagctgaagaaactggaggaggaccag
atcatcatggaggaccagaactgcaaactggccaaggagaagaaactgctggaagacaga
gtagctgaattcactaccaacctcatggaagaggaggagaagtccaagagcctggccaag
ctcaagaacaagcacgaggcaatgatcaccgacctggaagagcgcctccgtagggaggag
aagcagaggcaggagttggagaagacccgtcgcaagctggagggagactccacagacctc
agtgaccagattgctgagctccaggcgcagatagcagagctcaagatgcagctggccaag
aaggaggaggagttgcaggctgccttggccagagtggaagaagaagctgctcagaagaat
atggccctgaagaagatccgagaactggaaactcagatctctgagctccaggaggacctg
gagtcggagcgagcctccaggaataaagccgagaagcagaaacgggatctgggagaggag
ctggaggcgctgaagacagagctggaggacacgctggactccacggctgcccagcaggag
ctgaggtcgaagcgtgagcaggaggtgagcatcctgaagaagactctggaggacgaggcc
aagacccatgaggcccagatccaggagatgaggcagaagcactcacaggctgtggaggag
ctggcagatcagttggagcagacgaagcgggtaaaagctacccttgagaaggcgaagcag
accctggagaatgagcggggagagctggccaatgaggtgaaggccctgctgcaaggcaag
ggcgactcagagcacaagcgcaagaaggtggaggcgcagctgcaagaactgcaggtcaag
ttcagcgagggagagcgcgtgcgaaccgaactggccgacaaggtcaccaagctgcaggtt
gaactggacagtgtgaccggtctccttagccagtctgacagcaagtccagcaagcttacg
aaggacttctctgcgctggagtcccagcttcaggacacacaggagttgctccaggaggag
aaccggcagaagctgagcctgagcaccaagctcaagcagatggaggatgagaaaaactcc
ttcagggagcagctggaggaggaggaggaggccaagcgcaacttggagaagcagatcgcc
acgctccatgcccaggtgaccgacatgaagaagaagatggaggacggtgtagggtgcctg
gagactgcagaggaggcgaagcggaggcttcagaaggacttggaaggcctgagccagcgg
cttgaggagaaggtggctgcctacgataagctggagaagaccaagacacggctgcagcag
gagctggacgacctgctggttgacctggaccaccagcggcagagcgtctccaacctggaa
aagaagcagaagaagttcgaccagctcctagccgaggagaagaccatctcggccaagtat
gcagaggagcgtgaccgagctgaggctgaggcccgtgagaaggagacaaaggcgctatca
ctggcccgggcgcttgaggaggccatggagcagaaggcagagctggagcggctcaacaag
cagttccgcacggagatggaggacctcatgagctccaaggatgacgtgggcaagagtgtc
cacgagctggagaagtccaagcgggccttggagcagcaggtggaggagatgaagacccag
ctggaggagctggaggatgagctgcaggccacggaggatgccaagctccgcctggaggtg
aacctgcaggccatgaaggcccagtttgagcgggatctgcagggccgggatgaacagagc
gaggagaagaagaagcagctggtcagacaggtgcgggagatggaggcggagctggaggat
gagaggaagcagcgctccatggccatggccgcacgcaagaaactggagatggatctgaag
gacctggaggcacacattgacacagccaataagaaccgggaagaggccatcaaacagctg
cggaagcttcaggcccagatgaaggactgcatgcgggagctggacgacacgcgcgcctcc
cgggaggagatcctggcgcaggccaaggagaatgagaagaagctgaagagcatggaggcc
gagatgattcagctgcaggaggaactggcagctgctgagcgtgctaagcgtcaggcccaa
caggaacgggacgagctggctgatgagatcgccaacagcagtggcaaaggggccctagca
ttagaggagaagcggcgactggaggcccgcattgcccagctggaggaggagctggaggag
gaacagggcaacacggagctgatcaacgatcggctgaagaaggccaacctgcagatcgac
caaataaacaccgacctgaacctggaacgcagccacgcacagaagaatgagaatgcgcga
cagcagctggaacgccagaacaaggagctcaaggccaagctgcaggaaatggagagtgct
gtcaagtccaaatacaaggcctccatcgcggccttggaggccaaaattgcacagctggag
gaacagctggacaacgagaccaaggagcgccaggcagcctccaagcaggtgcgccggacg
gagaagaagctgaaggacgtgctgctgcaggtggaggacgagcggaggaacgcggaacag
ttcaaggaccaggctgacaaggcgtccacccgcctgaagcagcttaaacggcagctagag
gaggctgaagaggaggcccagcgggccaatgcctcacgccggaagctgcagcgtgagctg
gaagatgccacagagaccgctgatgctatgaaccgcgaggtcagctccctgaagaacaaa
ctgaggcgtggggacctgccatttgtcgtgactcgccgaattgttcggaaaggcactggc
gactgctcagacgaggaggtcgacggtaaagcagatggggccgatgccaaggcagctgaa
tag

DBGET integrated database retrieval system