KEGG   Mus musculus (mouse): 17898
Entry
17898             CDS       T01002                                 

Gene name
Myl7, MLC, MLC-2, MLC-2alpha, MLC2a, MYL2A, Mylc, Mylc2a, RL, RLC-A
Definition
(RefSeq) myosin, light polypeptide 7, regulatory
  KO
K12754  myosin regulatory light chain 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    17898 (Myl7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17898 (Myl7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17898 (Myl7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    17898 (Myl7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17898 (Myl7)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17898 (Myl7)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 CHCH EF-hand_9
Other DBs
NCBI-GeneID: 17898
NCBI-ProteinID: NP_075017
MGI: 107495
Ensembl: ENSMUSG00000020469
Vega: OTTMUSG00000005104
UniProt: Q9QVP4 Q5SVI8
Position
11 A1; 11 3.88 cM
AA seq 175 aa
MASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLKET
YSQLGRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQG
VVNKEEFKQLLMTQADKFSPAEVEQLFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt   +upstreamnt  +downstreamnt
atggccagtaggaaggctgggacccgaggcaaggctgcagccaccaagcaggcacaacgt
ggctcttctaatgtcttctcaatgttcgaacaagcccagattcaggaattcaaggaagcc
ttcagctgcattgaccagaacagggatgggatcatctgcaaatcagacctgaaggagacc
tattcccagctcgggagggtaagtgttccggaggaagagctggacgccatgctgcaggaa
gggaagggtcccatcaacttcaccgtcttcctcacactcttcggggagaagctcaatggg
acggaccccgaggaagccatcctgagtgccttccgcatgttcgaccccagcggccagggg
gtggtgaacaaggaagagttcaagcagcttctcatgacccaggcagacaagttctctcct
gctgaggtagagcaactgtttgcgctgacacccatggacctggccggcaacattgactac
aagtctctctgctacatcatcacccacggggatgagaaagaggagtag

KEGG   Mus musculus (mouse): 17906
Entry
17906             CDS       T01002                                 

Gene name
Myl2, Gm32672, MLC-, MLC-2, MLC-2s/v, MLC-2v, Mlc, Mlc2v, Myl, Mylpc
Definition
(RefSeq) myosin, light polypeptide 2, regulatory, cardiac, slow
  KO
K10351  myosin regulatory light chain 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    17906 (Myl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    17906 (Myl2)
   04530 Tight junction
    17906 (Myl2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17906 (Myl2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17906 (Myl2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17906 (Myl2)
   04261 Adrenergic signaling in cardiomyocytes
    17906 (Myl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    17906 (Myl2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    17906 (Myl2)
   05414 Dilated cardiomyopathy
    17906 (Myl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17906 (Myl2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17906 (Myl2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11
Other DBs
NCBI-GeneID: 17906
NCBI-ProteinID: NP_034991
MGI: 97272
Ensembl: ENSMUSG00000013936
Vega: OTTMUSG00000024649
UniProt: P51667
Position
5; 5 F
AA seq 166 aa
MAPKKAKKRIEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVR
EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcaccaaagaaagccaagaagcggatagaaggcgggagctccaacgtgttctccatg
tttgagcagacccagatccaggagttcaaggaagccttcacaatcatggaccagaacaga
gacggcttcatcgacaagaatgacctaagggacacatttgctgccctaggacgagtgaac
gtgaaaaatgaagagatcgatgaaatgatcaaagaggctccaggtccaattaacttcacc
gtgttcctcacgatgtttggggagaaacttaaaggggctgatcctgaagagaccattctc
aacgcattcaaggtgtttgatcccgagggcaaagggtcactgaaggctgactatgtccgg
gagatgctgaccacacaagcagagaggttctccaaagaggagatcgaccagatgttcgca
gcctttccccctgacgtcaccggcaatcttgattataagaatttggtccacatcattacc
cacggagaagagaaggactga

KEGG   Mus musculus (mouse): 17907
Entry
17907             CDS       T01002                                 

Gene name
Mylpf, 2410014J02Rik, MLC-, MLC-2, Mlc2
Definition
(RefSeq) myosin light chain, phosphorylatable, fast skeletal muscle
  KO
K12758  fast skeletal myosin light chain 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    17907 (Mylpf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17907 (Mylpf)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17907 (Mylpf)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    17907 (Mylpf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17907 (Mylpf)
   04147 Exosome [BR:mmu04147]
    17907 (Mylpf)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17907 (Mylpf)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   17907 (Mylpf)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 17907
NCBI-ProteinID: NP_058034
MGI: 97273
Ensembl: ENSMUSG00000030672
Vega: OTTMUSG00000023131
UniProt: P97457 Q545G1
Position
7; 7 F3
AA seq 169 aa
MAPKKAKRRAGAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcacccaagaaggccaagagaagggcaggagcggaagggagctccaacgtcttctcc
atgtttgaccagactcagatccaggagttcaaggaggcgttcactgtaattgatcagaac
agggatggcattatcgacaaagaggatcttcgggacacctttgcagccatgggccgtctc
aatgtgaagaatgaggaactcgacgctatgatgaaggaagccagtgggcccatcaacttc
actgtcttcctgaccatgtttggggaaaagcttaagggtgcggacccggaggatgtgatc
actggagccttcaaggtcctggacccagaagggaagggcaccatcaaaaagcagttcttg
gaggagctgcttaccacgcagtgcgaccgattttcccaggaggagatcaagaacatgtgg
gcagccttccccccagacgtgggcggcaacgtggactacaagaacatctgctacgtcatc
acacatggtgatgctaaggaccaggaatag

KEGG   Mus musculus (mouse): 59310
Entry
59310             CDS       T01002                                 

Gene name
Myl10, 1700027I08Rik, Mylc, Mylc2pl, P, PL, PLR, PLRLC
Definition
(RefSeq) myosin, light chain 10, regulatory
  KO
K12756  myosin regulatory light chain 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    59310 (Myl10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    59310 (Myl10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    59310 (Myl10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    59310 (Myl10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    59310 (Myl10)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     59310 (Myl10)
SSDB
Motif
Pfam: EF-hand_8 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5
Other DBs
NCBI-GeneID: 59310
NCBI-ProteinID: NP_001078856
MGI: 1891705
Ensembl: ENSMUSG00000005474
Vega: OTTMUSG00000054396
UniProt: Q62082
Position
5; 5 G2
AA seq 131 aa
MDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDP
EETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNL
CYVITHGEEKD
NT seq 396 nt   +upstreamnt  +downstreamnt
atggaccagaaccgcgatggcttcattgacaaggaggacctgagggacacctttgctgca
ctgggtcgcataaatgtcaagaacgaggaattggaagccatggtgaaggaggctccgggg
cccatcaacttcacagtcttcctgaccatgtttggggagaaactcaagggcacggaccca
gaagagactatactgcacgccttcaaagtgtttgacactgaaggaaaaggctttgtcaag
gctgacttcattaaggaaaagcttatgacgcaggctgaccggttcagtgaggaggaggtc
aagcagatgtttgcagctttcccgccagatgtctgtggcaacttagactacaggaatctg
tgctacgtcatcacacacggcgaggagaaggactag

KEGG   Mus musculus (mouse): 67268
Entry
67268             CDS       T01002                                 

Gene name
Myl12a, 2900073G15Rik, AI838292, C80200
Definition
(RefSeq) myosin, light chain 12A, regulatory, non-sarcomeric
  KO
K12757  myosin regulatory light chain 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    67268 (Myl12a)
   04530 Tight junction
    67268 (Myl12a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    67268 (Myl12a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    67268 (Myl12a)
   04670 Leukocyte transendothelial migration
    67268 (Myl12a)
  09158 Development and regeneration
   04360 Axon guidance
    67268 (Myl12a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    67268 (Myl12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    67268 (Myl12a)
   04147 Exosome [BR:mmu04147]
    67268 (Myl12a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     67268 (Myl12a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   67268 (Myl12a)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 UPF0154 EF-hand_9 Syntaxin SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 67268
NCBI-ProteinID: NP_001344749
MGI: 1914518
Ensembl: ENSMUSG00000024048
Vega: OTTMUSG00000033039
Position
17; 17 E1.3
AA seq 178 aa
MDLTATMSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDL
HDMLASMGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEA
IGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 537 nt   +upstreamnt  +downstreamnt
atggatttaaccgccaccatgtctagcaaaagggcaaagaccaagaccaccaagaagcgc
cctcagcgcgcaacctccaatgtgttcgccatgtttgaccagtcccagatccaggagttc
aaagaagcctttaacatgattgaccagaaccgggatggcttcattgacaaggaggacctg
cacgacatgctggcgtcaatgggaaaaaacccaactgacgaatacctggacgccatgatg
aacgaggccccgggccccatcaatttcaccatgttcctcaccatgtttggggagaagctg
aacggcactgaccccgaggacgtcatcagaaacgccttcgcttgctttgatgaggaagcc
atcggcaccatccaggaggattacctgagggagctgctgaccaccatgggcgaccgcttc
acagacgaggaggtggatgagctgtacagagaggcccccattgacaaaaaggggaacttc
aactacattgagttcacacgcatcctgaagcacggcgcgaaagacaaagatgactga

KEGG   Mus musculus (mouse): 67938
Entry
67938             CDS       T01002                                 

Gene name
Myl12b, 1500001M02Rik, C77744, Mylc2, Mylc2b, RLC, RLC-B
Definition
(RefSeq) myosin, light chain 12B, regulatory
  KO
K12757  myosin regulatory light chain 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    67938 (Myl12b)
   04530 Tight junction
    67938 (Myl12b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    67938 (Myl12b)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    67938 (Myl12b)
   04670 Leukocyte transendothelial migration
    67938 (Myl12b)
  09158 Development and regeneration
   04360 Axon guidance
    67938 (Myl12b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    67938 (Myl12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    67938 (Myl12b)
   04147 Exosome [BR:mmu04147]
    67938 (Myl12b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     67938 (Myl12b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   67938 (Myl12b)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666 DUF3741 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 67938
NCBI-ProteinID: NP_075891
MGI: 107494
Ensembl: ENSMUSG00000034868
Vega: OTTMUSG00000016301
UniProt: Q3THE2
Position
17; 17 E1.3
AA seq 172 aa
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaaaagcgaagaccaagaccaccaagaagcgccctcagcgcgcaacctcc
aatgtgttcgccatgtttgaccagtcccagatccaggagttcaaagaggcctttaacatg
attgaccagaaccgggatggcttcattgacaaggaggacctgcacgacatgctggcgtct
ctggggaagaatcccactgatgcctacctggacgccatgatgaacgaggccccgggcccc
atcaatttcaccatgttcctcaccatgtttggggagaagctaaacggcactgaccccgag
gacgtcatcagaaacgccttcgcttgctttgatgaggaagccacaggcaccatccaggag
gattacctgagggagctgctgaccaccatgggcgaccgcttcacagacgaggaagtggat
gagctgtacagagaggcccccattgacaaaaaggggaacttcaactacattgagttcaca
cgcatcctgaagcacggcgcgaaagacaaagatgactga

KEGG   Mus musculus (mouse): 98932
Entry
98932             CDS       T01002                                 

Gene name
Myl9, AI327049, MLC2, MLC20, Mylc2, Mylc2c, RLC, RLC-C
Definition
(RefSeq) myosin, light polypeptide 9, regulatory
  KO
K12755  myosin regulatory light chain 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    98932 (Myl9)
   04022 cGMP-PKG signaling pathway
    98932 (Myl9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    98932 (Myl9)
   04530 Tight junction
    98932 (Myl9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    98932 (Myl9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    98932 (Myl9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    98932 (Myl9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    98932 (Myl9)
  09158 Development and regeneration
   04360 Axon guidance
    98932 (Myl9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    98932 (Myl9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    98932 (Myl9)
   04147 Exosome [BR:mmu04147]
    98932 (Myl9)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     98932 (Myl9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   98932 (Myl9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 98932
NCBI-ProteinID: NP_742116
MGI: 2138915
Ensembl: ENSMUSG00000067818
Vega: OTTMUSG00000016035
UniProt: Q9CQ19
Position
2; 2 H1
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaagagagccaaggccaagaccaccaagaagaggccccagagggctacgtcc
aatgtcttcgccatgtttgaccagtcccagatccaggagtttaaggaggccttcaacatg
attgatcagaaccgagatggcttcattgataaggaggacctgcacgacatgctggcctct
ctggggaagaaccccacagacgagtatctggagggcatgatgaacgaggcgccagggccc
atcaacttcaccatgttcctcacaatgtttggggagaagctgaacggcacagaccccgag
gatgtgatccgcaatgcctttgcctgctttgatgaggaggcctcaggcttcatccacgag
gaccacctgagggagctgctcaccaccatgggcgaccgattcacggatgaggaggtggac
gagatgtaccgcgaggcacccattgataagaagggcaacttcaactacgtggagttcact
cgcatcctcaaacacggcgccaaggacaaggacgactaa

DBGET integrated database retrieval system