KEGG   Mus musculus (mouse): 17909Help
Entry
17909             CDS       T01002                                 

Gene name
Myo10, AW048724, D15Ertd600e, mKIAA0799, myosin-X
Definition
(RefSeq) myosin X
  KO
K12559  myosin X
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    17909 (Myo10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17909 (Myo10)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17909 (Myo10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head PH MyTH4 SH3_19 FERM_M MYO10_CC PH_8 IQ PH_3 PH_11 RA ACBP PH_9 AAA_22 AAA_16
Motif
Other DBs
NCBI-GeneID: 17909
NCBI-ProteinID: NP_062345
MGI: 107716
Ensembl: ENSMUSG00000022272
Vega: OTTMUSG00000020342
UniProt: F8VQB6 Q80TR9
Position
15 B1; 15 9.36 cM
AA seq 2062 aa AA seqDB search
MDSFFPEGARVWLRENGQHFPSTVNSCAEGVVVFQTDYGQVFTYKQSTITNQKVTAMHPL
HEEGVDDMASLAELHGGSIMYNLFQRYKRNQIYTYIGSIIASVNPYQPIAGLYERATMEE
YSRCHLGELPPHIFAIANECYRCLWKRHDNQCVLISGESGAGKTESTKLILKFLSVISQQ
TLDLGLQEKTSSVEQAILQSSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQQGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYALLAGLDQGEREEFYLSLPENYHYLNQSGCTEDKTI
SDQESFRQVITAMEVMQFSKEEVREVLRLLAGILHLGNIEFITAGGAQIPFKTALGRSAD
LLGLDPTQLTDALTQRSMILRGEEILTPLSVQQAVDSRDSLAMALYARCFEWVIKKINSR
IKGKDDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLV
WEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVA
VNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTL
KCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNTQKMPDQFDQVVVLNQLRYS
GMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPDDIRGKCTVLLQVYDASNSEWQLG
KTKVFLRESLEQKLEKRREEEIDRAAMVIRAHILGYLARKQYRKVLCGVVTIQKNYRAFL
ARKKFLHLKKAAIVFQKQLRGQLARRVYRQLLAEKRELEEKKRREEEKKREEEERERERA
QREADLLRAHQEAETRRQQELEALQKSQREADLTRELEKQRENKQVEEILRLEKEIEDLQ
RMKERQELSLTEASLQKLQQLRDEELRRLEDEACRAAQEFLESLNFDEIDECVRNIERSL
SVGSEISGEELSELAESASGEKPNFNFSQPYPAEEEVDEGFEADDDAFKDSPNPSEHGHS
DQRTSGIRTSDDSSEEDPYMNYTVVPTSPSADSTVLLAASMQDSASLHNSSSGESTYCMP
QNNGDLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRYSVGTYNSSGAYRF
SSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRW
CVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEK
LKGTVEVRTAKEIIDNTSKENGIDIILADRTFHLIAESPEDASQWFSVLSQVHSSTDQEI
REMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWI
TLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNA
LKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVT
DTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNL
LKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNK
VPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFIYESL
KKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAME
DSRNMFALFEYNGQVDKAIESRTIVADVLAKFEKLAATSEAGDAPWKFYFKLYCFLDTDS
MPKDSVEFAFMFEQAHEAVIHGHHPAPEESLQVLAALRLQYLQGDYTPHTSIPPLEEVYS
VQRLRARISQSTKTFTPYERLEKRRTSFLEGTLRRSFRTGSVVRQKAEEEQMLDMWIKEE
VCSARTSIIDKWKKLQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVS
ADAVSVYKRGEGKPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAY
ISMIVKKRYSTTRSVSSQGSSR
NT seq 6189 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttctttcccgagggagcacgggtctggctaagagaaaatggccagcatttt
ccgagtactgtaaattcctgtgcagaaggcgtcgtggtcttccagacagactatgggcag
gtgttcacctacaagcagagtacaatcaccaaccagaaggtgacagctatgcaccccctg
cacgaggagggcgtggacgacatggcttccctggccgagctccatgggggctccatcatg
tacaaccttttccagcgctacaaaaggaaccaaatctatacctacatcggctccatcatc
gcgtcagtgaacccctaccagcccatcgctggcctgtacgagcgcgccaccatggaggag
tacagcaggtgccacctgggcgagcttccaccgcacatcttcgccattgccaacgaatgc
tatcgctgcttgtggaagcgccatgacaaccaatgtgtcctcatcagcggggaaagcgga
gctgggaaaacggaaagcaccaagctgatcctcaagttcctgtccgtcatcagccagcag
actttggacctgggcctgcaggagaagacatccagcgtcgagcaagccatccttcaaagc
agcccaatcatggaagcatttggcaatgcgaagacagtatacaacaacaactccagtcgc
ttcgggaagtttgttcagctgaacatctgccagcagggaaacattcagggaggaagaatt
gtagattatttattagaaaaaaaccgagtagtgaggcagaatcccggggagaggaattat
cacatattctatgcactgctggcagggctggaccagggagagcgagaagaattttattta
tctttgccagaaaactaccattacttgaatcagtctgggtgtacggaagacaagacgatc
agcgaccaggaatccttcagacaagttatcacggcaatggaagtcatgcaattcagcaag
gaggaagttcgggaagttttgaggttgctggcgggaattctgcatctcggcaacatagag
tttatcactgctggaggggcgcagattcccttcaaaacagctttgggtaggtctgcggac
ttgcttgggctggacccaacgcagctcacagatgcactgacccagagatccatgatcctc
aggggagaagagatcctgacgcctctcagtgtccagcaggccgtagatagcagagactca
ttggccatggcactttatgctcgctgctttgagtgggtgatcaagaagatcaacagccgg
atcaaaggcaaagacgacttcaaatccatcggcatccttgacatcttcggatttgaaaac
ttcgaggttaaccactttgagcagttcaatatcaactatgcaaatgaaaagcttcaggaa
tacttcaacaaacacattttttccttagaacaactagaatatagcagggagggattggtg
tgggaagatattgactggatagacaatggagaatgtctagacctgatcgagaagaaactt
ggcctcctcgccttgatcaatgaagagagccattttcctcaagccacagacagcactttg
ttggagaagctacacagtcagcatgctaataaccacttttatgtgaaaccccgcgttgca
gtcaacaattttggcgtgaagcattatgcaggagaggtgcagtatgatgtccgaggcatc
ttggaaaagaacagagacacattcagagatgaccttctcaacctgctcagggaaagcagg
ttcgacttcatctatgacctctttgaacacgtctccagccgcaacaaccaggacaccttg
aaatgcggaagcaaacaccggcggcccactgtcagctcgcagttcaaggactccctgcac
tccttaatggcaacactaagctcctcaaatcctttctttgtcagatgcatcaagccaaac
acacagaagatgccagaccagtttgatcaggtggtagtgctcaaccagctgcgctactcg
gggatgctggagacggtgaggattcggaaagcagggtatgccgtcagaagaccctttcag
gacttttacaaaaggtataaagtgctgatgaggaacttggccctgcctgacgacatccga
gggaagtgcactgtgctcctgcaggtctatgacgcttctaacagcgagtggcagctgggg
aagaccaaggtcttccttcgagaatccttggagcagaaactggaaaagaggcgggaagag
gagattgaccgtgcggccatggtgatccgagctcacatcttaggctacttggcacgaaag
caatatagaaaggtcctctgtggtgtggtgaccatacagaagaattacagagctttcctt
gcgaggaagaaatttttgcacctgaaaaaggcagccatcgtgttccagaagcaactgcga
ggacagctggcacgcagggtttacaggcagctgttggctgagaaacgggagctggaggaa
aagaagaggcgggaggaagagaagaagagagaggaagaggaaagagaaagagagcgagcg
caaagagaagctgacctcctccgtgcccatcaggaggcagagacaaggaggcagcaagaa
ctggaagccttgcagaagagccagagggaagcggacttgaccagggagctggaaaagcaa
agggagaacaagcaggtggaggagatcctccgcctggagaaggaaatcgaggatctgcag
cgcatgaaggagcggcaggagctgtcgttgaccgaggcctccctgcagaagctgcagcag
ctgcgggatgaggagttgcgcaggctggaggatgaggcctgccgcgccgcccaggagttc
ttggagtcgctcaacttcgacgagatcgacgagtgcgtccgcaacatcgagcgctccctg
tcggtagggagcgagatttcgggcgaagagctcagtgagcttgccgagagtgccagcgga
gagaagccaaacttcaacttcagccagccctaccccgcggaggaggaggtggacgagggc
ttcgaggcggatgacgacgccttcaaggactcgcccaaccccagcgagcacggccactcc
gaccagcgaacgagtggcatccggacgagcgacgactcatccgaggaggacccttacatg
aactacacggtggtgcccaccagccccagtgccgacagtacggtgcttcttgctgcgtcc
atgcaggactccgctagcctgcacaactcctcgagtggggagtccacctactgcatgccg
cagaacaacggcgacctgccctcccccgacggcgactatgactatgaccaggacgattac
gaggatggcgccatcacgtcaggcagcagcgtgactttctccaactcctatggaagccag
tggtcccccgactacaggtattccgtgggaacctacaacagttccggagcgtaccggttc
agctcagaaggggcgcagtcctcctttgaagacagcgaggaggacttcgactccaggttt
gatacagatgatgaactttcctaccggcgagactctgtgtatagctgcgtcacactgccc
tatttccacagttttctgtacatgaaaggtggcttaatgaactcctggaagcgccgctgg
tgtgtcctgaaggacgagaccttcctgtggttccgctccaagcaggaagccctcaagcaa
ggctggctgcacaagaaaggcgggggctcctccacgctgtcccggaggaactggaagaag
cgctggtttgtccttcgccagtcgaagctgatgtactttgaaaacgatagcgaggagaag
ctcaagggcaccgtggaagtccgcaccgccaaggagatcatagacaacacaagcaaagag
aacgggatcgacatcatcctggccgacaggaccttccatctcatcgcggagtcccccgaa
gatgccagccaatggttcagcgtgctgagtcaggtccactcgtccacagaccaggagatc
agagaaatgcatgatgagcaggcaaacccccagaatgctgtgggcacactggatgtcggg
ctgattgattctgtatgcgcctctgacagccctgatagacccaactcatttgtgatcatc
acagccaaccgggtgctgcactgtaacgcggacaccccagaggagatgcaccactggata
accctgctgcagagatccaagggggacaccagggtggagggccaggagttcatcgtcaga
gggtggctgcataaggaagtgaagaacagtccgaagatgtcctccctgaaactgaagaaa
cggtggttcgtgctgacgcacaattccctggactactacaagagctcagagaagaacgct
ctgaaactgggcactctggtcctcaacagcctgtgctccgttgtgcccccagacgagaag
atattcaaagagacaggctactggaatgtcaccgtgtatgggcgcaaacactgttaccga
ctctacacgaaactactgaacgaggcgactaggtggtccagcgccatccagaatgtgact
gacaccaaggctccaatcgacacgcccacccagcagctgatccaagatattaaggagaac
tgcctcaactctgacgtggtggagcagatttacaagcggaacccgatccttcgctacacg
catcacccgctgcactccccgctcctgcctcttccctatggggacataaatctcaacctg
ctgaaagacaaaggctacacgacccttcaggacgaagccatcaagatattcaattctctc
caacaactggagtccatgtccgaccccatccctatcatccagggcatcctgcagaccggg
cacgacctgcggcctctgcgggatgaactgtattgtcagctcatcaaacagaccaacaag
gtgccccatcccggcagcgtgggcaacctttacagctggcagatcctgacctgcctcagc
tgcaccttcctgccgagccgcgggatcctcaaatacctcaagttccacctgaaaaggata
cgggaacagttcccaggaaccgagatggagaagtacgccctctttatctacgaatccctt
aagaaaaccaaatgcagagagtttgtgccttcccgagatgaaatcgaagctctgatccac
cggcaggaaatgacgtccacagtgtattgccatggcggaggctcctgcaagatcaccatc
aactcccacaccacagccggggaggtggtggagaagctgatccgagggctcgccatggag
gacagcaggaacatgtttgccttgtttgagtacaacggacaggtggacaaggccatcgaa
agccggaccatcgtagctgacgtcctggcaaagtttgaaaagctagctgccacgtcagaa
gccggggacgcgccatggaaattctacttcaaactttattgcttcctggacaccgacagc
atgccaaaagacagcgtggagtttgcgtttatgtttgaacaggcccacgaagccgtcatc
catggccaccacccagcccctgaggaaagcctccaagtgctggctgccctgagactgcag
tatctgcagggcgactataccccgcacacctccatcccacccctcgaggaggtttactct
gtgcagagactcagagctcgcattagtcagtcgaccaaaaccttcaccccgtacgagcgc
ctcgagaagagacggaccagcttcctggagggcacgctgcggcggagcttccggaccggg
tcggtggttcggcagaaggcggaggaggagcagatgctggacatgtggatcaaggaggaa
gtctgctcggctcgcaccagcatcattgacaagtggaagaaactgcaggggatgaaccag
gaacaagccatggccaagtatatggccctgatcaaggagtggcctggttatggatcaaca
ctctttgatgtggagtgcaaagaaggcggcttcccccaggagctctggctgggcgtcagc
gcagacgccgtgtctgtctacaagcgtggagagggcaaaccgttagaagtcttccagtat
gagcacatcctctcgttcggggcaccgctggccaacacgtacaagatcgtagttgacgag
cgggagctgctctttgagacgagtgaggtggtggatgtggccaagctcatgaaagcgtat
atcagcatgattgtgaagaagcgctatagcaccacacgctctgtgagcagccagggcagc
tccaggtga

DBGET integrated database retrieval system