KEGG   Mus musculus (mouse): 17912
Entry
17912             CDS       T01002                                 

Gene name
Myo1b, AA406997, MIH-L, MMIa
Definition
(RefSeq) myosin IB
  KO
K10356  myosin I
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    17912 (Myo1b)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17912 (Myo1b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17912 (Myo1b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17912 (Myo1b)
   04147 Exosome [BR:mmu04147]
    17912 (Myo1b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     17912 (Myo1b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Others
    17912 (Myo1b)
 Others
  Actin-binding proteins
   Myosins
    17912 (Myo1b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    17912 (Myo1b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17912 (Myo1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   17912 (Myo1b)
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 IQ AAA_16 AAA_22
Other DBs
NCBI-GeneID: 17912
NCBI-ProteinID: NP_034993
MGI: 107752
Ensembl: ENSMUSG00000018417
Vega: OTTMUSG00000016470
UniProt: P46735 Q7TQD7
Position
1 C1.1; 1 26.58 cM
AA seq 1107 aa
MAKMEVKSSLLDNMIGVGDMVLLEPLNEETFIDNLKKRFDHNEIYTYIGSVVISVNPYRS
LPIYSPEKVEDYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKL
VMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDP
LGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLYKLKLERDFSRYNYLSLDSA
KVNGVDDAANFRTVRNAMQIVGFLDHEAEAVLEVVAAVLKLGNIEFKPESRVNGLDESKI
KDKNELKEICELTSIDQVVLERAFSFRTVEAKQEKVSTTLNVAQAYYARDALAKNLYSRL
FSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTL
KEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILAMLDEECLRPGTVTDETFLEKLN
QVCATHQHFESRMSKCSRFLNDTTLPHSCFRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQ
AMWKAGHSLIKSLFPEGNPAKVNLKRPPTAGSQFKASVATLMRNLQTKNPNYIRCIKPND
KKAAHIFNESLVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPA
RSGVEVLFNELEIPVEEHSFGRSKIFIRNPRTLFQLEDLRKQRLEDLATLIQKIYRGWKC
RTHFLLMKRSQVVIAAWYRRYAQQKRYQQIKSSALVIQSYIRGWKARKILRELKHQKRCK
EAATTIAAYWHGTQARRELKRLKEEARRKHAVAVIWAYWLGLKVRREYRKFFRANAGKKI
YEFTLQRIVQKYLLEMKNKMPSLSPIDKNWPSRPYLFLDSTHKELKRIFHLWRCKKYRDQ
FTDQQKLIYEEKLEASELFKDKKALYPSSVGQPFQGAYLEINKNPKYKKLKDAIEEKIII
AEVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAV
HLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVK
FIQGNQKNGSVPTCKRKNNRLLEVAVP
NT seq 3324 nt   +upstreamnt  +downstreamnt
atggccaaaatggaggtgaaatcctcacttctggacaatatgatcggtgttggagatatg
gttcttttagagccgctcaatgaggagacgttcatcgacaacctgaagaagcgcttcgac
cacaatgagatatatacatacattgggagcgtggttatatctgttaacccctaccggtcc
ttgcccatatattcgccggagaaagtggaagattacagaaatagaaacttctatgaactg
agccctcacatctttgctttgtcggatgaagcatacagatccctccgtgatcaagataaa
gatcaatgcattctcattactggggagagtggagcaggaaaaacagaggccagcaagctc
gtcatgtcctatgtcgctgccgtgtgcggaaaaggagcagaagtcaatcaggtcaaggaa
cagcttctgcagtccaaccctgtcctggaagcttttggaaatgccaagactgtgaggaat
gacaactcatctagattcggcaaatacatggatattgaatttgactttaaaggcgatccg
ctgggaggagtgataagtaactatcttttagagaaatctcgtgttgttaagcagccaaga
ggtgaaagaaacttccatgtgttctatcagctgctctcaggcgcctctgaggagctcctc
tacaagcttaagctggagcgggatttcagcagatacaactatctgagtctggactctgct
aaagttaatggtgtggatgatgctgccaatttcagaactgttaggaatgcgatgcagatc
gtgggctttctggatcatgaggccgaggctgtcctggaggtagtggcagccgttttgaaa
ctggggaacatcgagttcaagcctgaatcacgagtgaatggtttggatgaaagcaaaatc
aaagataaaaatgagttaaaagaaatttgcgagttgaccagcatcgatcaggtggtttta
gaaagagcgttcagtttccgaacagttgaagcgaagcaggagaaagtttcaaccacgctg
aatgtggctcaggcttattatgcccgtgatgccctggctaaaaacctctacagccgcttg
ttttcatggttggtaaatcgtatcaacgaaagcattaaggcacaaacaaaagtgagaaag
aaggtcatgggtgttctggacatttatggctttgaaatatttgaggataacagcttcgag
cagtttattattaactattgtaatgaaaagcttcaacaaatcttcatcgaacttaccctc
aaagaagagcaagaggaatatattcgggaggacatagaatggactcacattgactacttc
aacaatgctatcatttgtgacctaatagaaaataacacaaatggaatcttggccatgctg
gatgaagagtgcctgagacccggcactgttacagatgagaccttcctggaaaagctgaac
caagtctgtgccacccaccagcactttgagagcaggatgagcaagtgttcccgctttctc
aacgacacaaccctgccccacagctgcttcagaatccagcattatgctggcaaggtgctc
taccaggtggaaggatttgttgacaagaacaatgaccttctgtaccgggacctgtctcaa
gccatgtggaaggccggccactccctcatcaagtctctgtttcctgaaggaaatcctgca
aaggtcaacctgaagagacctcccaccgcaggctcccagttcaaggcgtctgtggccacg
ctgatgagaaacctgcagaccaagaacccgaactacatcaggtgcatcaagccaaatgat
aaaaaggcagctcacattttcaatgagagtctcgtatgccatcagatcaggtacctgggt
cttttggagaacgttcgagtgagacgggcaggctatgccttcaggcaggcctatgaacct
tgcctggaaagatacaagatgctttgcaaacaaacgtggcctcactggaagggaccagca
aggtctggcgtggaggttctgtttaatgagctagagattcctgtggaagagcactccttc
gggagatccaagatattcatccgaaacccacggacattattccaactagaagacctaagg
aagcagcggctggaggacctggccactctcattcagaagatttatcgaggatggaaatgc
cgtacacattttctgctcatgaaaagaagccaagttgtgattgctgcctggtacaggaga
tatgcgcaacaaaagcggtaccagcagataaagagttcagccctggtgattcagtcgtac
atccggggctggaaggctcgaaaaatcctgcgggagctgaagcatcagaagcgctgtaag
gaggcagccaccaccatcgcggcgtactggcatggcacccaggcacggagggagttgaaa
cgcttgaaggaggaggctaggcgtaagcatgcagttgctgtcatttgggcttactggctt
ggactgaaggtacgcagggaatacaggaaattctttagagcaaatgctggaaagaaaatc
tatgagtttacacttcaaagaattgtgcaaaaatacttgttggaaatgaaaaataaaatg
ccttccttgtcaccgatagataaaaattggccatcaagaccttacctgttcttggattcg
actcacaaggagctaaaaaggatcttccacttgtggaggtgtaaaaaatacagggatcaa
ttcacagaccagcagaaacttatttatgaagagaagctcgaggccagcgaactcttcaaa
gacaagaaggctttatatccttctagtgttgggcaaccattccaaggagcttacctggaa
atcaacaagaacccaaaatataagaaactcaaagatgccattgaagagaagatcattatt
gctgaggttgtgaacaaaattaatcgggctaatgggaagagtacatctcggattttcctc
ttaacaaacaataaccttctccttgctgaccaaaagtctgggcagatcaagtccgaggtc
cccctggtagatgtgaccaaggtttccatgagttcccagaacgatggtttctttgcagtg
cacctcaaggagggttcagaagcggctagtaaaggggactttctcttcagcagtgaccac
ctgattgaaatggcaaccaagctgtatcgcacgactctcagccaaactaaacagaagctc
aacatcgagatttccgatgagttcctggtacagttcagacaggacaaagtatgtgtgaag
tttattcaaggcaaccagaaaaatgggagcgtgccaacctgcaaacgaaagaacaacaga
ctccttgaagtcgctgtcccttaa

DBGET integrated database retrieval system