KEGG   Mus musculus (house mouse): 17919
Entry
17919             CDS       T01002                                 
Symbol
Myo5b, mKIAA1119
Name
(RefSeq) myosin VB
  KO
K10357  myosin V
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04814  Motor proteins
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04814 Motor proteins
    17919 (Myo5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    17919 (Myo5b)
   04131 Membrane trafficking [BR:mmu04131]
    17919 (Myo5b)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17919 (Myo5b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17919 (Myo5b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Cargo complex
     17919 (Myo5b)
   mRNA cycle factors
    P-body specific factors
     17919 (Myo5b)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Myosins
    17919 (Myo5b)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    17919 (Myo5b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17919 (Myo5b)
SSDB
Motif
Pfam: Myosin_head DIL IQ HalX nSTAND3 Myosin_N AAA_16 AAA_22
Other DBs
NCBI-GeneID: 17919
NCBI-ProteinID: NP_963894
MGI: 106598
Ensembl: ENSMUSG00000025885
UniProt: G5E8G6
Position
18:74575435..74905769
AA seq 1818 aa
MSYSELYTRYTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDDTILEYPVDVQNNQVP
FLRNPDILVGENDLTALSHLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYG
QDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYF
ATVGGSASDTNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKFIEIGFDKKYHIIGANMR
TYLLEKSRVVFQADDERNYHIFYQLCAAASLPEFKELALTCAEDFFYTAHGGNTTIEGVN
DADDFEKTRQALTLLGVRDSHQISIFKIIASILHLGSVEIQSERDGDSCSISPQDEHLSN
FCSLLGIEHSQMEHWLCHRKLVTTSETYVKTMSLQQVVNARDALAKHIYAQLFSWIVEHI
NKALHTSLKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMK
EQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYERHSNSQHFQK
PRMSNTAFIVNHFADKVEYLSDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDSAP
ATNTAKNRSSSKINVRSSRPLIKVPNKEHKKSVGYQFRTSLNLLMETLNATTPHYVRCIK
PNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWTYHDFFNRYRVLMKKRELTNT
DKKNICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATIMIQKSVRGWL
QRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRAT
VIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKA
RQELKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSEQLSAVTSSHAVEV
EKLKKELAHYQQNQEADTSLQLQEEVQSLRTELQKAHSERRVLEDAHNKENGELRKRVAD
LEHENALLKDEKEYLNNQILCQSKAESSQSSVEENLLMKKELEEERSRYQNLVKEYSQLE
QRYENLRDEQTPGHRKNPSNQSSLESDSNYPSISTSEIGDTEDALQQVEEIGIEKAAMDM
TVFLKLQKRVRELEQERKKLQAQLEKGQQDSKKGQVEQQNNGLDVDQDADIAYNSLKRQE
LESENKKLKNDLNELRKAVADQAMQDNSTHSSPDSYSLLLNQLKLANEELEVRKEEVLIL
RTQIMNADQRRLSGKNMEPNINARTSWPNSEKHVDQEDAIEAYHGVCQTNRLLEAQLQAQ
SLEHEEEVEHLKAQVEALKEEMDKQQQTFCQTLLLSPEAQVEFGVQQEISRLTNENLDFK
ELVEKLEKNERKLKKQLKIYMKKVQDLEAAQALAQSDRRHHELTRQVTVQRKEKDFQGML
EYHKEDEALLIRNLVTDLKPQMLSGTVPCLPAYILYMCIRHADYTNDDLKVHSLLSSTIN
GIKKVLKKHNDDFEMTSFWLSNTCRFLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEY
RQVLSDLSIQIYQQLIKIAEGLLQPMIVSAMLENESIQGLSGVRPTGYRKRSSSMVDGEN
SYCLEAIVRQMNSFHTVLCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDACSWSTGM
QLRYNISQLEEWLRGKNLHQSGAVQTMEPLIQAAQLLQLKKKTHEDAEAICSLCTSLSTQ
QIVKILNLYTPLNEFEERVTVSFIRTIQAQLQERNDPQQLLLDSKHVFPVLFPYNPSALT
MDSIHIPACLNLEFLNEV
NT seq 5457 nt   +upstreamnt  +downstreamnt
atgtcgtacagcgagctctacacccggtacacaagggtctggatccctgacccagatgag
gtgtggcgctcggctgaattaaccaaggactacaaagaaggggataagagcctgcagctc
agactagaagatgacacaattctagaatacccagttgatgtccaaaataaccaggtgcca
ttcttgcggaatccagatatcttagtaggagaaaacgacctcactgccctcagccacctc
cacgagcccgcagttctgcataacttaaaggtccgtttcctggaatccaaccacatctac
acttactgtggaattgtgcttgttgccatcaacccctacgagcagctgccaatctacgga
caggatgtcatctatgcctacagtggccaaaacatgggtgacatggacccccacatcttt
gctgtggcagaagaagcctacaagcagatggccagagatgaaaagaaccaatccatcata
gtcagcggagagtctggagcaggcaagacggtgtcggccaagtacgccatgcgctatttt
gccaccgttggtggctcagccagtgataccaacattgaagagaaggtcctagcatccagc
cccatcatggaggccattgggaacgccaagactactcgcaacgacaacagcagccgattt
gggaaattcattgagattggctttgataaaaagtaccacatcattggggccaacatgagg
acctacttgctggagaagtccagggtggtctttcaggcggatgacgagaggaactaccac
atcttttaccagctctgtgctgctgccagccttcctgaatttaaagagctcgccctaacg
tgcgcagaggactttttctatacagcccatggaggaaacacgaccatcgagggtgtgaat
gatgcagacgactttgagaagactagacaagccctcacactcctgggagtgcgggattcc
catcaaataagcatctttaagataattgcttctatcttgcacctgggaagtgtggagatt
cagtctgagcgggacggggattcctgcagcatttcaccccaggatgaacacttgagcaac
ttctgcagcctgctaggaatagaacacagccagatggagcactggctgtgtcatcggaag
ctggtcaccacctcagagacctacgtcaagaccatgtccctgcagcaagtggtcaatgca
cgtgatgccttagccaagcacatctatgctcagctgttctcctggattgtggagcacatc
aacaaagccctgcacacctcccttaagcagcactccttcatcggggtcctggatatctat
gggtttgagaccttcgagatcaatagctttgaacagttttgtatcaactacgccaatgaa
aagctccagcaacagttcaattcgcatgtgttcaagctggagcaagaagaatatatgaag
gagcagatcccgtggactttgattgacttctacgataaccaaccgtgtatagacctcata
gaggcaaagctgggcatcctggacctgttggatgaggagtgtaaggtccccaaaggaact
gatcagaactgggcccagaaactctacgaacgacactccaacagccagcacttccagaaa
ccacgcatgtccaacacggccttcattgtcaaccactttgcagataaggtggagtacctt
tcagatggttttctagagaaaaacagggatacagtatatgaagaacagatcaacatcctg
aaggccagcaagttcccattagtggctgatttgttccacgatgacaaggactctgctcca
gccaccaacacagctaagaatcgatcatcttcaaagatcaacgttcgctcttccagaccc
ctcatcaaagtccctaacaaggagcacaagaaatccgtgggctaccagtttcgtacttcc
ctaaacctgcttatggagaccctgaatgccacaacgccacactatgtccggtgcatcaag
cccaacgatgaaaagcttcccttccactttgaccccaagagagctgtacagcaactccga
gcctgcggtgtgctggagaccattcggatcagcgcggcaggctacccatccaggtggacc
taccatgacttcttcaaccggtatcgggtgttgatgaagaagagagagctcaccaacacc
gacaagaagaatatctgcaagtctgtcctggagagtctcatcaaggacccagacaagttc
cagtttggccgcaccaagatcttcttccgagcaggccaggtggcctacctggagaagctt
cgggcagacaagttccgggaagctactatcatgatccagaagtcggtcaggggatggctg
cagagagtgaagtaccgtaggctgagggcagctaccttatccctgcagaggttctgcagg
ggatacctagcccgcaggctggccgaacacttgaggagaacccgggccgccatcgtgttc
cagaagcagtaccgcatgctgaaggcccgccgagcctaccgcagggtctgcagggctacc
gtcatcatccagtccttcacacgggccatgtttgtgcgcaggaactaccgccaggtcctc
atggagcacaaagccaccatcatccagaagtacgcccgaggctggatggcacggaagcgt
tttctgcgggagcgggatgcagccattgtcatccagtgtgccttccggagactcaaggcc
aggcaggagctgaaggccctcaagattgaggcccgctcggcagagcatctgaaacgcctc
aacgtgggcatggagaacaaagtcgtccagctacagcggaagattgatgaccagaacaaa
gagttcaagactctgtcagagcagctgtctgcagtcacctccagtcatgccgtggaggtg
gagaagctgaagaaggagctggcacattaccagcagaaccaggaggctgataccagcctt
cagctgcaggaggaggttcagagcctgcgcactgaactacagaaggctcattcggagcgc
agggtcctggaggatgctcacaacaaggagaatggcgagctgagaaagcgagttgcagac
ctggaacatgaaaatgccctcttgaaggatgaaaaagaataccttaacaaccaaatcctg
tgccagtcaaaagctgaatcttcgcagagctctgtggaagagaacctcctgatgaagaag
gagctggaggaggaacggtccaggtaccagaacctcgtgaaggagtactcccagctggag
cagagatatgagaaccttcgggacgagcaaactccgggccacaggaagaacccatcgaac
caaagcagcttagaatctgactccaattacccctccatttccacttccgaaatcggagac
actgaggatgcccttcagcaggtggaggagattggcatagagaaggcagccatggacatg
accgtcttcctgaagctgcagaagagagtgcgcgaacttgagcaggagaggaagaagctg
caggcacagctagaaaagggacagcaggacagcaagaaagggcaggtagaacaacagaac
aatggcttagatgtggaccaggacgcagatatagcctacaatagtctgaagagacaggag
cttgagtcagagaacaagaagctgaagaatgacctgaatgagctgaggaaggctgtcgct
gaccaagccatgcaggataactccacccacagctccccagacagctacagcctcctcctg
aaccagctcaagctggccaatgaggagctcgaggtccgcaaagaggaggtgctgatcctc
aggacccagatcatgaatgccgaccagcgccgcctgtctggcaagaacatggagccgaac
atcaatgccagaacaagttggcccaacagtgagaagcacgtggaccaggaagacgccatt
gaggcctatcacggggtctgccagacaaacaggttgctggaggcccagctgcaggcccag
agcctggagcatgaggaggaggtggaacatctcaaggcccaggtggaagccctgaaagag
gagatggacaaacagcagcagaccttctgccagaccctgctgctctccccagaggcccag
gtagaatttggtgtccagcaggagatatcccggctgaccaatgagaacctggattttaag
gaattggtggaaaagctggagaagaatgagaggaagctgaagaagcagctgaagatttac
atgaagaaggtccaggacttagaagctgctcaggcgttggcacagagtgacaggagacac
catgaactcacaagacaggtcacagtccaacgaaaagagaaggacttccaaggcatgctg
gagtaccacaaagaggacgaagccctcctcatccggaacctggtgacagacctgaagcct
cagatgctgtcgggcaccgtgccctgtctgcctgcatacatactctatatgtgcatcagg
cacgcggattacaccaacgatgacctcaaggtgcactcgttgctgagctccaccatcaac
ggcattaagaaagtcctcaagaagcacaatgatgactttgagatgacgtcattctggcta
tccaacacctgccgcttccttcactgtctgaagcaatacagtggtgatgagggtttcatg
acacagaacactgcgaagcagaatgagcactgtctcaagaactttgacctcactgaatac
cgccaggtgctaagcgacctttccattcagatctatcagcagctcattaaaatcgccgag
ggcttgctgcagcctatgatagtttctgccatgttggaaaatgagagtatccaggggctg
tctggtgtgagaccaactggttaccggaagcgctcctccagcatggtggatggagagaat
tcgtattgcctggaggccatcgtccgccagatgaattctttccatacagtcctgtgtgac
cagggtctggaccccgagattatcctgcaggtgttcaaacagctcttctacatgatcaac
gctgtgactcttaacaacctactcctgcggaaagacgcctgctcctggagcacaggcatg
caactcaggtacaacataagtcaactggaagagtggcttcggggcaaaaaccttcaccaa
agtggagcagttcagaccatggagcccctcatccaggcagcccagctcctccagctgaag
aagaaaacccacgaggatgctgaggccatctgctctctgtgcacctccctcagcacccag
cagattgtcaaaattttaaacctctacactcccttgaatgaatttgaggaacgggtcaca
gtgtccttcatacgaacaatccaggctcagctacaagagaggaatgaccctcagcagctc
ctgctggactccaagcacgtgttcccagttctgtttccatataacccatctgctctgacc
atggactcgatccacatcccggcctgtctcaacctggagtttctcaatgaagtctga

DBGET integrated database retrieval system