KEGG   Mus musculus (mouse): 17925
Entry
17925             CDS       T01002                                 

Gene name
Myo9b
Definition
(RefSeq) myosin IXb
  KO
K10360  myosin IX
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17925 (Myo9b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17925 (Myo9b)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    17925 (Myo9b)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17925 (Myo9b)
SSDB
Motif
Pfam: Myosin_head RhoGAP RA IQ C1_1 AAA_22 SWIRM-assoc_1 T2SSE Zf_RING zf-RING_9
Other DBs
NCBI-GeneID: 17925
NCBI-ProteinID: NP_001135794
MGI: 106624
Ensembl: ENSMUSG00000004677
Vega: OTTMUSG00000062152
UniProt: Q3TRQ0 E9PZW8
Position
8 B3.3; 8 34.43 cM
AA seq 2128 aa
MSAHEAGSSGRRQQATYHLHIYPQLSSAGSQTSCRVTATKDSTTSDVIQDVVASLHLDGS
KHYVLVEVKESGGEEWVLDASDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGSIQY
LPIQLLAQPTAACRLVERGLLPRPQADFDDLCNLPELTEANLLQNLKLRFMQQKIYTYAG
SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYAMLRKHVNQCIVISGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYLENGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERLEFQLKQPQD
YFYLNQHNLNIEDGEDLKHDFERLQQAMEMVGFLPATKKQIFSVLSAILYLGNVTYKKRA
TGRDEGLEVGPPEVLDTLSQLLKVKRETLVEVLTKRKTVTVNDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDMEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFTQHIFKLEQEEYQGEGISWHNIDYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSHTLLAKFKQQHEDNKYFLGTPVLEPAFIIQHFAGRVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRQLIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGISSPAT
RSHMEELPRGASTPSEKLYRDLHNQIIKSLKGLPWQGEDPRRLLQSLSLFQKPRTSFLKS
KGIKQKQIIPKNLLDSKSLRLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE
ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
QFQVLLPKDVQPCREAIAALLEKLQVDRQNYQIGKTKVFLKETERQTLQEKLHGEVLRRI
LQLQSWFRMVLERKHFVQMKHAALTIQACWRSYRVRRALERTQAAVYLQAAWRGYLQRQA
YHHQRHSIIRLQSLCRGHLQRRSFSQMVSEKQKAEQAREAAGGKLSEGEPGPVAAGEQLS
EHPVEDPESLGVEAETWMNKSPDGMSPKKETPSPEMETAAQKTVPAESHEKVSSSREKRE
SRRQRGLEHVERQNKHIQSCREESSTHREPSRRASLEIGESFPEGTKGPREDGLEAWTET
TAPSSSKQAQVVGDPPGSPSPVQRPTTLALDSRVSPMLPSSSLEVSPVLPSSSLESPKDK
DKDESSTKAQDKPESPSGSTQIQRYQHPDTERLATAVEIWRGKKLASAVLSQSLDLSEKH
RATGAALTPTEERRISFSTSDVSKLSPVKVQTSAEIDGDFSSKKPSIHKKKSGDPSAGPD
AGLSPGSQGDSKSAFKRLFLHKAKDKKPSLEGVEETESNGGQAAQETPARKTLDVPSSQQ
HRHTTGEKPLKGKKNRNRKVGQITVSEKWRESVFRKITNANELKFLDEFLLNKVNDLRSQ
KTPIESLFIEATERFRSNIKTMYSVPNGKIHVGYKDLMENYQIVVSNLAAERGEKDTNLV
LNVFQSLLDEFTRSYNKTDFERAKQSKAQKKKRKQERAVQEHNGHVFASYQVNIPQSCEQ
CLSYIWLMDKALLCSVCKMTCHKKCVHKIQSYCSYTGRRKSELGAEPGHFGVCVDSLTSD
KASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQALQTDPAAVKLEDFPIHAIT
GVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLSAIYAVLDHLPEANHTSLERLIFH
LVKVALLEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKY
KMKMEEINHLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVRIKSPRTPVVQDLELGA
LPEEAAGGDEDREKEILMERIQSIKEEKEDITYRLPELDPRGSDEENLDSETSASTESLL
EERGVRGAVEGPPAPALPCPISPTLSPLPEAAAPPRGRPTSFVTVRVKTPRRTPIMPMAN
IKLPPGLPLHLTSWAPALQEAVVPVKRREPPARRQDQVHSVYIAPGADLPSQSTLIALDH
DTILPGTKRRYSDPPTYCLPPSSGQANG
NT seq 6387 nt   +upstreamnt  +downstreamnt
atgagtgcgcacgaggctggcagctcgggccgtcggcagcaggccacctaccacctgcac
atctacccgcagctgtccagcgctgggagccagacctcatgccgtgtgaccgccaccaag
gacagcacaacaagcgatgtcatccaggatgtggtggccagcctacacctggatggctcg
aagcactacgtgctggtggaggtgaaggagtcaggcggggaggagtgggtgttggatgcc
agcgactcacctgtacaccgagtgctactgtggcctcggcgagctcaggacgagcaccct
caggaggatggctactacttcttgctgcaggaacgcaatgctgatggcagtattcagtac
ctgcccatacagctgctggctcagcctacagctgcatgtcgcctggtagagcgagggctg
ttgccgaggcctcaagcagactttgatgacctgtgcaacctgccagagctgactgaagcc
aacctgctgcagaacctgaagctgcgcttcatgcagcaaaagatctacacatacgcgggc
agcatcctggtggccatcaacccctttaagttcctgcccatttacaaccccaagtatgtg
aagatgtatgagaaccaacagctgggcaaactggagccacatgtgttcgctctggccgat
gtagcctactacgccatgctgcgcaagcacgtgaaccagtgtatcgtcatctctggtgag
agtggctctggcaagacacagagcaccaacttcctcatccactgcctcacagcgctcagc
cagaagggctatgccagtggcgtcgaaaggaccatcctgggagcagggcctgtgctggag
gcttttgggaatgccaagacagcccacaacaacaactccagccgcttcgggaagttcatc
caagtcaactacctagaaaatggcattgtgaggggagctgttgtggaaaaataccttctt
gaaaagtctcgcctggtttcccaggagaaggatgagcggaactaccatgtgttttattat
ctgctgctgggtgtcagtgaggaggagcgcctggaatttcagctgaagcagcctcaagac
tatttctacctcaaccagcataacttgaatattgaagatggagaagacctcaaacatgac
tttgaaaggcttcagcaggccatggagatggtgggcttcctgcctgccaccaagaagcag
atcttctctgtcctctcagccatcctgtaccttggcaatgtcacctacaagaagagagcc
acaggccgagatgaaggcctggaggtcggtcctccagaggtgttggacaccctctcccag
ctcttaaaggtaaagcgggagaccctggtggaggtcttaaccaagagaaaaacagttaca
gtcaatgacaaactcatcctgccttacagcctcagtgaggccataactgcacgagactcc
atggccaagtccctatacagtgccctatttgactggattgtgctaaggatcaaccacgcc
ctcctcaacaagaaggacatggaagaggctgtttcctgcttgtccattggcgtcctggac
atctttggatttgaggacttcgaaaggaatagctttgagcagttttgcatcaactatgcc
aatgagcagttgcagtactacttcacccagcacatcttcaagctggagcaggaggagtac
cagggtgagggcatctcgtggcacaacattgactacaccgacaacgtgggctgtatccac
ctcatcagcaagaagcccactggcctcttctacctgctggacgaggagagcaacttccca
catgccacaagccacactttgctggccaagttcaagcagcagcatgaggacaataagtac
ttcctgggcacaccagtcctggagcccgccttcatcatccagcacttcgcgggcagagtg
aaataccagatcaaggacttccgggagaagaacatggactacatgcggcctgacatcgtg
gcactgctaaggggcagtgacagctcctatgtgcgccagctcattggcatggacccggta
gctgtgttccgctgggctgtactacgagcagccatcagggccatggctgtgctgcgggag
gctgggcgcctgcgtgcagagagagcggagaaggcagcaggtataagtagccctgccact
cgaagtcacatggaagagctaccaagaggagccagtaccccttcagaaaaactgtaccgc
gatttgcataaccaaatcatcaagagcctcaaaggactgccatggcagggcgaggacccg
aggaggcttctccagtccctcagtctgttccagaagccccgcacctccttcctgaagagt
aaaggtatcaaacaaaagcagatcattcccaagaacctgctggactcgaagtccctgagg
ctcatcatcagcatgacactgcatgaccgaactaccaagtcactgctgcacctgcacaaa
aagaagaagccacctagcatcagtgcacagttccagacatctcttaacaagctgttggag
gcactgggcaaggccgagcccttcttcatccgctgcatccgctccaatgccgagaagaag
gaactttgctttgatgatgaactggtgctgcagcaactgcgctacacaggcatgctagag
actgtgcgcatccgacgctctggctacagcgccaagtacaccttccaggacttcacggag
cagttccaggtgttgctgcccaaggatgtccagccctgtagggaggccattgctgccctg
ctggagaagctgcaggtggacaggcagaactaccagattggaaagacgaaggtcttcctg
aaggagacagagcgtcagaccctgcaggagaagctgcatggtgaggtcctgcgtagaatc
ctgcagctgcagagttggttccgtatggtgctggaacgcaagcactttgtacagatgaag
catgctgccttgaccatccaggcctgctggcggtcttaccgtgtgcgccgtgcactggaa
aggacgcaggcagctgtgtacctgcaggctgcctggaggggctacctgcagagacaggcc
taccaccaccagaggcatagcatcatccgcctgcagagcctctgccgtggccacctgcag
cgcaggagcttcagccagatggtgtcagagaagcagaaggcagagcaagccagggaggca
gcaggaggaaagctgtcagagggtgagcctggccccgtggccgctggggagcagctatct
gagcaccctgtggaagaccctgagagcctgggtgtggaggctgaaacctggatgaacaag
tccccagacggcatgtcacctaagaaggagacacccagcccagagatggagaccgcagcc
caaaagacagtgccagctgaaagtcatgagaaagtctccagtagccgagagaagcgagag
tcacggcggcaacgagggttggagcatgttgaacgacagaataaacacatccaatcctgc
agggaggagagcagcacccaccgagaaccttccagaagggcaagcctggaaataggggaa
agcttccctgagggcacaaagggacccagagaagatggacttgaggcatggactgagacc
acagccccctctagttcaaagcaggcacaggttgtgggagacccacctgggagtcccagt
cccgtgcagaggcccaccaccctggccctagacagtagggttagcccaatgctccccagc
agctccctggaggttagcccagtgctccccagcagctccctggaatcccccaaagataag
gacaaggatgagagcagcaccaaggctcaggacaagcccgagagtcccagtggctccacc
cagatccaacgataccaacacccagacacagagcggctggccactgctgtagagatatgg
cgaggcaagaagcttgccagtgccgtgctgagccaatccctggacctgagtgagaagcac
cgggctacaggggcagccctgactcccacagaggagaggcgcatctctttctccaccagt
gacgtctccaagctgtccccagtcaaggtacagacttcagctgaaatcgatggggacttt
agcagcaagaagccatccatccataagaagaagtcaggagatccatccgctggtcctgat
gcaggcctgtctccaggctcccagggtgactctaaatctgcatttaagcggctcttcctg
cacaaagccaaggataagaagcccagcctggagggtgtagaggagacagagagcaatgga
gggcaggctgcacaggagaccccggccaggaagactctagacgtaccttctagccagcag
caccgccataccacaggtgagaagcccctaaaagggaagaagaaccgaaatcgcaaagtt
ggccagatcacagtgtccgagaagtggcgagagtcagtgttccgtaagatcactaatgcc
aatgagctcaagtttctggacgagttcctgctcaacaaggtgaatgaccttcgctcacag
aagacacccatcgaaagcttgttcattgaggccactgagcgcttcaggagcaacatcaag
accatgtattcggtgcctaatgggaagatccatgtaggctacaaggacctgatggagaac
taccagatcgttgtcagtaacctggctgccgagcgtggggagaaggacaccaatctggtc
ctcaatgtcttccagtcactgctggatgagttcacccgcagctacaacaagactgacttt
gagcgggccaagcagagcaaagcccagaagaagaagcggaagcaggagcgtgctgtccag
gaacacaatggacatgtgtttgccagctaccaggtgaacattccacagtcatgtgagcag
tgtctgtcctacatctggctcatggacaaggctctactgtgcagtgtgtgcaagatgacc
tgccacaagaaatgcgtgcacaagattcagagctattgctcctacactggaaggaggaag
agtgagctgggtgccgaaccaggccacttcggtgtgtgtgtagacagcctgaccagtgac
aaggcctccgtgcccattgtgctggagaagcttctggaacacgtagagatgcatggcctg
tacactgagggcctttaccgcaagtcaggagctgccaaccggacacgggaattacgccag
gcactgcagacagaccctgctgcagttaagctggaagacttccctatccacgctatcacc
ggggtcctgaagcaatggcttcgtgagctgcctgagccactcatgacttttgcccagtat
ggagatttcctcagggctgttgagcttccagagaagcaggagcagctgtctgccatctat
gcagtcctggaccacctgccagaagccaaccacacctccctggagcgactcatcttccac
cttgtcaaagtggccctgcttgaagatgtgaaccgcatgtctccgggagctctagctatc
atctttgcaccctgcctgcttcgctgccctgacaactccgaccccctgaccagcatgaag
gatgtactgaagatcaccacgtgtgtggagatgctcatcaaagaacagatgaggaagtac
aagatgaagatggaggaaatcaaccacctggaggctgctgagagcattgcattccgcagg
ctctccctgttgaggcagaatgctccgtggcctctcaaactggggttttcatcaccctat
gagggggtccggatcaaaagccccaggaccccagtggtccaagacctggagctgggggct
ctccccgaggaggctgcaggtggcgacgaggaccgagaaaaggagattctcatggagagg
atccagtccatcaaggaagagaaggaggacatcacatatcgactgccggagctggaccca
cggggttctgatgaggagaaccttgactcagagacatcggccagcactgagagcctgctg
gaggagaggggcgtgcggggggccgtggaagggccccccgcacctgctctcccctgcccc
atttcgcccaccctgagtcccctccccgaggccgccgcccctccacgaggaaggccgaca
tccttcgtcacggtcagagtgaagacacctcggaggacccccatcatgcccatggccaat
atcaagctccctccgggcctgcccttgcacctgacaagctgggcacctgctctccaggag
gctgttgttccagtgaagcgccgagagccacctgcccgcagacaggaccaggtacattcc
gtatacatcgcccctggggctgacctgccatcacagagtacactgatagccctggaccat
gataccatacttcctgggaccaagcgcaggtattcggacccccctacctactgcctgccc
cccagctccggccaggccaatggctga

DBGET integrated database retrieval system