KEGG   Mus musculus (mouse): 17926
Entry
17926             CDS       T01002                                 

Gene name
Myoc, AI957332, GLC, GLC1A, TI, TIGR
Definition
(RefSeq) myocilin
  KO
K23027  myocilin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17926 (Myoc)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     17926 (Myoc)
SSDB
Motif
Pfam: OLF FPP ADIP NYD-SP28_assoc Cep57_MT_bd BRE1 CENP-H YabA ATG16 APG6_N CadC_C1 FapA YlqD bZIP_1 Spc7 DUF3450
Other DBs
NCBI-GeneID: 17926
NCBI-ProteinID: NP_034995
MGI: 1202864
Ensembl: ENSMUSG00000026697
Vega: OTTMUSG00000051917
UniProt: O70624 Q05AC1
Structure
PDB: 
6NAX 5VR2

Position
1 H2.1; 1 70.29 cM
AA seq 490 aa
MPALHLLFLACLVWGMGARTAQFRKANDRSGRCQYTFTVASPNESSCPREDQAMSAIQDL
QRDSSIQHADLESTKARVRSLESLLHQMTLGRVTGTQEAQEGLQGQLGALRRERDQLETQ
TRDLEAAYNNLLRDKSALEEEKRQLEQENEDLARRLESSSEEVTRLRRGQCPSTQYPSQD
MLPGSREVSQWNLDTLAFQELKSELTEVPASQILKENPSGRPRSKEGDKGCGALVWVGEP
VTLRTAETIAGKYGVWMRDPKPTHPYTQESTWRIDTVGTEIRQVFEYSQISQFEQGYPSK
VHVLPRALESTGAVVYAGSLYFQGAESRTVVRYELDTETVKAEKEIPGAGYHGHFPYAWG
GYTDIDLAVDESGLWVIYSTEEAKGAIVLSKLNPANLELERTWETNIRKQSVANAFVICG
ILYTVSSYSSAHATVNFAYDTKTGTSKTLTIPFTNRYKYSSMIDYNPLERKLFAWDNFNM
VTYDIKLLEM
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgccagctctccatctgctgtttctggcctgcttggtgtggggaatgggggccaggaca
gcacagttccgaaaggccaatgatcggagtggccgatgccaatacaccttcactgtggcc
agccccaatgaatctagctgcccaagggaggaccaggccatgtcagccatccaagacctt
cagagagacagcagcatccagcatgcagacctagagtccaccaaggcccgggtcagatcc
ctggagagtctcctccaccagatgaccttgggccgagttactgggacccaggaggcccaa
gaggggctgcagggccagttgggtgccctgaggagagaacgggaccagctggagacccaa
accagggatctggaggcagcctataacaatctccttcgagataagtcggctttagaggaa
gagaagaggcagctggaacaagagaatgaagatttggccaggaggctagaaagcagcagc
gaggaggtaacaaggctgcggaggggccagtgtccttccacccagtacccctctcaggac
atgctgccaggctccagggaagtctctcagtggaatttggacacgttggccttccaggaa
ttgaagtcagagttaactgaggttcctgcttcccaaatcttgaaggaaaatccatctggc
cgacccaggagcaaagaaggagacaaaggatgtggagcgctagtctgggtaggagagcca
gtcaccctgaggacagctgaaacaatcgctggcaagtatggagtgtggatgagagacccc
aagcccacccacccctacacccaggaaagcacatggaggattgacacggttggcacagag
atccgccaggtgtttgagtacagtcagataagccagttcgagcagggctatccttccaag
gtccatgtgctccctcgggcactggagagcacgggtgctgtggtgtatgcggggagcctc
tatttccagggggctgagtccagaactgtggtcaggtatgagctagacacggagaccgtg
aaggcagagaaggaaattcctggagctggctaccacggacacttcccgtacgcgtggggt
ggctacacagacattgacttagctgtggatgagagcggcctctgggtcatctacagcacg
gaggaagccaagggggccatagtcctctccaaattgaacccagcgaacctggaacttgag
cgtacctgggagactaacatccgtaagcagtctgtggccaatgcctttgttatctgtggc
atcttgtacacggtgagcagctactcttcagcccatgcaaccgtcaacttcgcctacgac
actaaaacggggaccagtaagaccctgaccatcccattcacgaatcgctacaagtacagc
agtatgattgactacaaccccctggagaggaagctgtttgcctgggacaacttcaacatg
gtcacctatgatatcaagctcttggagatgtga

DBGET integrated database retrieval system