KEGG   Mus musculus (mouse): 17931
Entry
17931             CDS       T01002                                 

Gene name
Ppp1r12a, 1200015F06Rik, 5730577I22Rik, AA792106, AV099298, D10Ertd625, D10Ertd625e, Mypt, Mypt1
Definition
(RefSeq) protein phosphatase 1, regulatory subunit 12A
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    17931 (Ppp1r12a)
   04022 cGMP-PKG signaling pathway
    17931 (Ppp1r12a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    17931 (Ppp1r12a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17931 (Ppp1r12a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    17931 (Ppp1r12a)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    17931 (Ppp1r12a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    17931 (Ppp1r12a)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    17931 (Ppp1r12a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    17931 (Ppp1r12a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     17931 (Ppp1r12a)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3 PRKG1_interact
Other DBs
NCBI-GeneID: 17931
NCBI-ProteinID: NP_082168
MGI: 1309528
Ensembl: ENSMUSG00000019907
UniProt: Q9DBR7
Position
10 D1; 10 56.33 cM
AA seq 1004 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERVMLRD
ARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMETVNKVGQTAFDVADEDILGYLEELQKKQTLLHSEKRDKKSP
LIESTANMENNQPQKAFKNKETLIIEPEKNASRIESLEHEKADEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPMASVSNAHTSSTQAAPAAVTAPTLSSNQGTPTSPVKKFPISTTK
ISPKEEERKDESPASWRLGLRKTGSYGALAEISASKEAQKEKDTAGVMRSASSPRLSSSL
DNKEKEKDNKGTRLAYVTPTIPRRLASTSDIEEKENRESSSLRTSSSYTRRKWEDDLKKN
SSINEGSTYHRSCSFGRRQDDLISCSVPSTTSTPTVTSAAGLQRSLPSSTSTAAKTPPGS
SSAGTQSSTSNRLWAEDSTEKEKDSAPTAVTIPVAPTVVNAAAPSTTTLTTTTAGTVSEV
RERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTREQ
ENEEKEKEEKEKQDKEKQEEKKESEASREDEYKQKYSRTYDETYTRYRPVSTSSSSAPSS
SSLSTLGSTLYASSQLNRPNSLVGITSAYSRGLAKENEREGEKKEEEKEGEDKSQPKSIR
ERRRPREKRRSTGVSFWTQDSDENEQERQSDTEDGSSKRETQTDSVSRYDSSSTSSSDRY
DSLLGRSASYSYLEDRKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLK
LQLEKATQRQERFADRSQLEMEKRVAGKSQYLLGGTKSSRKKNI
NT seq 3015 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagccgcccgtggtgaagcgccagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctcgccgcctgctccagcggcgacacggacgaggtcctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcaccgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcaaatatcaat
caacctgacaatgaaggctggataccactccatgcagctgcttcctgtggatatctcgat
attgcagagtttttgattggtcaaggagcacatgtaggagctgtcaacagtgaaggagac
acacctttagatattgcagaggaggaggcgatggaagagctacttcaaaatgaggttaat
cggcaaggtgttgatatagaagcggctcggaaagaggaggagcgggtaatgctaagagac
gcgaggcagtggttaaacagcggccacatcagtgacgtccggcatgcaaagtccgggggc
acagcactccacgtggcggccgccaaaggctatacagaagtgttaaaacttttaatacag
gcaggctatgatgttaatattaaagattatgatggctggacacctcttcatgctgcagct
cattggggtaaagaagaagcatgtcggattttagtggacaatctgtgtgatatggagacg
gtcaacaaagtgggccaaacagcctttgatgtagcagatgaagacattttgggatatcta
gaagagttgcaaaaaaaacaaactctgctccatagtgagaagcgggataagaaatctcca
ctgatcgagtccacagcaaatatggaaaacaatcaaccacagaaggcttttaaaaacaag
gaaacgttgattattgagccagagaaaaatgcatctcgcatcgagtctctggagcatgag
aaggctgatgaggaggaagaaggcaagaaggacgagtcgagctgttccagtgaggaggac
gaggaggacgattcagagtcagaggcagagacagataagacaaagcccatggcttctgta
agcaatgctcatacttccagcacgcaggcagcccctgcagctgttacagcacctactctg
tcttccaaccaggggacccctacatcacctgttaaaaagtttccaatatcgactacaaaa
atttctcccaaagaagaggaaagaaaagatgagtctcctgcatcctggaggttagggctt
cgaaagactggcagttacggtgccctggctgaaatcagtgcgtctaaagaagcccagaag
gagaaagacactgcaggggtgatgcggtcggcttccagtccgagactctcgtcctctttg
gataataaagaaaaggagaaagataacaaaggaacgagacttgcgtatgtcacccctaca
atcccgagacgactagccagtacatctgacattgaagagaaggagaacagagagtcttca
agtttgcgaacaagtagttcttacacaagaagaaaatgggaagatgatcttaaaaagaat
agttcgatcaatgaaggatccacttaccatagaagttgctcctttggtagaagacaagat
gatttgattagttgtagtgttccaagcaccacatcaacaccaacagttacctctgcagcg
gggcttcagagaagcctcccttccagcacaagcactgctgcaaagactcccccgggttcc
tcctccgcaggcacacagagcagtacctcaaatcgtttgtgggctgaggatagtactgag
aaagaaaaggacagtgctcctactgcagtgaccattcctgtggctccaactgttgtaaat
gctgcagctccttccaccaccaccctgactacaactactgctggcactgtttccgaggtc
agggagagacgcaggtcatacctcactcctgttagggacgaagagtctgaatcccaaaga
aaagcaagatctagacaagcaagacagtctagacggtcaacacagggggtaacactgact
gatcttcaggaagctgaaaaaacaataggaagaagtcgttctacgagaaccagagaacaa
gaaaatgaagagaaagaaaaagaagaaaaggaaaagcaggataaagagaaacaagaagaa
aagaaggagtcagaagcatctagagaagatgaatataaacaaaagtattcaagaacatac
gatgagacttacacacgttatagacctgtgtcaacttcaagttcaagcgctccgtcgtcg
tcctcactctctactctaggcagcacactctatgcctcaagtcagctcaacaggccaaac
agtcttgtaggtataacctctgcctactcccggggattagccaaagaaaacgagagagag
ggagagaaaaaagaagaggagaaagaaggggaagataagtcacagcctaagtcaatcaga
gaacgacggcgacccagagaaaagcgacggtctactggagtctccttctggacacaagat
agtgatgaaaatgagcaagagcggcaatcggacactgaggacggctccagcaagagagag
acgcagacggattctgtttccaggtatgacagcagttccacatcatcaagtgatcggtat
gattccttgctgggtcgctctgcttcatacagttacttagaagacagaaaaccttacagt
agcaggctagaaaaggatgactcaactgacttcaaaaagctttatgaacaaattttagct
gaaaatgaaaagctaaaagcacagctacatgatacaaatatggaactaacggatctaaag
ttgcagttggaaaaggctacccagagacaagaacgatttgctgacaggtcacaattggag
atggaaaaaagggtggccggcaagagtcagtatcttctgggcggaacgaagagctctaga
aagaagaatatctga

KEGG   Mus musculus (mouse): 19045
Entry
19045             CDS       T01002                                 

Gene name
Ppp1ca, Pp, Ppp1c, dis, dism2
Definition
(RefSeq) protein phosphatase 1 catalytic subunit alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04720  Long-term potentiation
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04931  Insulin resistance
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05168  Herpes simplex virus 1 infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    19045 (Ppp1ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    19045 (Ppp1ca)
   04024 cAMP signaling pathway
    19045 (Ppp1ca)
   04022 cGMP-PKG signaling pathway
    19045 (Ppp1ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19045 (Ppp1ca)
   04218 Cellular senescence
    19045 (Ppp1ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19045 (Ppp1ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19045 (Ppp1ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19045 (Ppp1ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    19045 (Ppp1ca)
   04921 Oxytocin signaling pathway
    19045 (Ppp1ca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19045 (Ppp1ca)
   04270 Vascular smooth muscle contraction
    19045 (Ppp1ca)
  09156 Nervous system
   04728 Dopaminergic synapse
    19045 (Ppp1ca)
   04720 Long-term potentiation
    19045 (Ppp1ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19045 (Ppp1ca)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    19045 (Ppp1ca)
  09165 Substance dependence
   05031 Amphetamine addiction
    19045 (Ppp1ca)
   05034 Alcoholism
    19045 (Ppp1ca)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    19045 (Ppp1ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    19045 (Ppp1ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19045 (Ppp1ca)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    19045 (Ppp1ca)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19045 (Ppp1ca)
   03041 Spliceosome [BR:mmu03041]
    19045 (Ppp1ca)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19045 (Ppp1ca)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     19045 (Ppp1ca)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     19045 (Ppp1ca)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     19045 (Ppp1ca)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    19045 (Ppp1ca)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 19045
NCBI-ProteinID: NP_114074
MGI: 103016
Ensembl: ENSMUSG00000040385
UniProt: P62137
Structure
PDB: 
5ZQV 5ZT0

Position
19; 19 A
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactccatcatcgggcgcctgctggaagtgcag
ggctcacggcctgggaagaacgtgcagctgacagagaacgagatccgtggtctgtgcctc
aaatcccgggagattttcctgagccagcccattcttctggagcttgaggcgcccctcaag
atctgtggtgacatccatggccagtactatgaccttctacggctgtttgagtatggtggc
ttccctccagagagcaactacctcttcttgggggattatgtagatcggggcaagcagtct
ttggagaccatctgcctgttgctggcctataagatcagatacccggagaatttctttcta
cttcgtgggaaccatgagtgtgccagcatcaaccgcatttatggcttctatgatgaatgc
aagagaagatacaacatcaaactgtggaagacgttcactgactgcttcaactgcctgccc
attgcagccattgtggatgagaagatcttctgctgccacgggggcctgtctccagacttg
caatccatggagcagattaggcgtattatgcggcccacagacgtgcctgaccagggccta
ctgtgtgatctcctgtggtctgaccctgacaaggatgttcaaggctggggcgagaatgac
cgtggtgtctcctttacctttggggctgaggtggtagccaagttcctgcacaagcatgat
ttggacctcatctgcagagcacatcaggttgtagaagatggctatgagttctttgccaag
agacagttggtgacactcttctcagctcccaactactgtggagagtttgacaatgctggt
gccatgatgagtgtggatgagaccctcatgtgttccttccagatcctcaagcccgctgat
aagaataagggcaagtatgggcagttcagcggcctgaaccccggaggccggcccatcact
ccaccccgcaattctgccaaagccaagaaatag

KEGG   Mus musculus (mouse): 19046
Entry
19046             CDS       T01002                                 

Gene name
Ppp1cb, 1200010B19
Definition
(RefSeq) protein phosphatase 1 catalytic subunit beta
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04720  Long-term potentiation
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04931  Insulin resistance
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05168  Herpes simplex virus 1 infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    19046 (Ppp1cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    19046 (Ppp1cb)
   04024 cAMP signaling pathway
    19046 (Ppp1cb)
   04022 cGMP-PKG signaling pathway
    19046 (Ppp1cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19046 (Ppp1cb)
   04218 Cellular senescence
    19046 (Ppp1cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19046 (Ppp1cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19046 (Ppp1cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19046 (Ppp1cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    19046 (Ppp1cb)
   04921 Oxytocin signaling pathway
    19046 (Ppp1cb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19046 (Ppp1cb)
   04270 Vascular smooth muscle contraction
    19046 (Ppp1cb)
  09156 Nervous system
   04728 Dopaminergic synapse
    19046 (Ppp1cb)
   04720 Long-term potentiation
    19046 (Ppp1cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19046 (Ppp1cb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    19046 (Ppp1cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    19046 (Ppp1cb)
   05034 Alcoholism
    19046 (Ppp1cb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    19046 (Ppp1cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    19046 (Ppp1cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19046 (Ppp1cb)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    19046 (Ppp1cb)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19046 (Ppp1cb)
   03041 Spliceosome [BR:mmu03041]
    19046 (Ppp1cb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19046 (Ppp1cb)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     19046 (Ppp1cb)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     19046 (Ppp1cb)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     19046 (Ppp1cb)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    19046 (Ppp1cb)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 19046
NCBI-ProteinID: NP_766295
MGI: 104871
Ensembl: ENSMUSG00000014956
Vega: OTTMUSG00000024328
UniProt: P62141
Position
5; 5 B1
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagcctcatcacccgcctgctggaggtacgagga
tgtcgtccaggaaagattgtacaaatgactgaagcagaagtccgagggttgtgtatcaag
tctcgtgaaatctttctcagccagcctattcttttggaattggaagcaccactgaagatt
tgtggagacattcatggacaatatacagacttactaagattatttgaatatggaggtttt
ccaccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatctgtttgctattggcttacaaaatcaaatacccggagaacttctttcttcta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctacgatgagtgtaaa
cgaagatttaatattaaattgtggaagacattcactgattgttttaactgtctgcctata
gctgctattgttgatgagaaaatcttctgttgtcatggaggactgtcaccagacctacaa
tctatggaacagattcggagaattatgagacccactgacgtacctgatacaggtttgctt
tgtgacttactgtggtccgacccagataaggatgtgcaaggctggggagaaaatgaccgt
ggtgtttcttttacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gacttgatttgtcgagctcatcaggtggtggaagacggatatgaattttttgctaaacga
cagttggtaaccttattttctgccccaaattactgtggcgagtttgacaatgctggtggt
atgatgagtgtggatgagactttgatgtgttcattccagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtgggctgaattctggacgtcctgtcactccgcctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Mus musculus (mouse): 19047
Entry
19047             CDS       T01002                                 

Gene name
Ppp1cc, P, PP-1G, PP1, dis2m1
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04720  Long-term potentiation
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04931  Insulin resistance
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05168  Herpes simplex virus 1 infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    19047 (Ppp1cc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    19047 (Ppp1cc)
   04024 cAMP signaling pathway
    19047 (Ppp1cc)
   04022 cGMP-PKG signaling pathway
    19047 (Ppp1cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19047 (Ppp1cc)
   04218 Cellular senescence
    19047 (Ppp1cc)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19047 (Ppp1cc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19047 (Ppp1cc)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19047 (Ppp1cc)
  09152 Endocrine system
   04910 Insulin signaling pathway
    19047 (Ppp1cc)
   04921 Oxytocin signaling pathway
    19047 (Ppp1cc)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19047 (Ppp1cc)
   04270 Vascular smooth muscle contraction
    19047 (Ppp1cc)
  09156 Nervous system
   04728 Dopaminergic synapse
    19047 (Ppp1cc)
   04720 Long-term potentiation
    19047 (Ppp1cc)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19047 (Ppp1cc)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    19047 (Ppp1cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    19047 (Ppp1cc)
   05034 Alcoholism
    19047 (Ppp1cc)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    19047 (Ppp1cc)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    19047 (Ppp1cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19047 (Ppp1cc)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    19047 (Ppp1cc)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19047 (Ppp1cc)
   03041 Spliceosome [BR:mmu03041]
    19047 (Ppp1cc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19047 (Ppp1cc)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     19047 (Ppp1cc)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     19047 (Ppp1cc)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     19047 (Ppp1cc)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    19047 (Ppp1cc)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 19047
NCBI-ProteinID: NP_038664
MGI: 104872
Ensembl: ENSMUSG00000004455
Vega: OTTMUSG00000016349
UniProt: P63087 Q6ZWM8
Structure
PDB: 
4V0W 4V0V 4V0X 4V0U

Position
5; 5 F
AA seq 323 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcggatatcgacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagccaggcaagaatgtccagctccaggagaacgagatccgaggactctgcctg
aagtctcgggagatcttcctcagtcagcctatccttttagaacttgaagcaccactcaag
atatgtggtgacatccacgggcagtactatgatttgctccgtctgtttgaatacggtggc
tttcctccagagagcaactatttgtttctcggggactatgtggacaggggcaagcagtcc
ctggagacaatctgcctcttgctggcctacaaaatcaagtatccggagaacttctttctt
ctcagagggaaccacgagtgcgccagcatcaataggatctacggattttatgatgagtgt
aaaagaagatacaacattaagctgtggaaaacgttcacagactgttttaactgcttgccg
atagcagccatcgtggacgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgagaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggctatgagttttttgcaaag
aggcagttagtcactctgttttctgcacccaactactgtggcgagtttgacaatgcaggc
gccatgatgagtgtggatgagaccctcatgtgttccttccagattttaaagcctgcagag
aaaaagaagcccaacgccacgagacctgtcacaccaccacggggtatgatcacaaagcaa
gcaaagaaatag

KEGG   Mus musculus (mouse): 232807
Entry
232807            CDS       T01002                                 

Gene name
Ppp1r12c, 2410197A17Rik, AI839747, B430101M08, Mbs8, Mbs85
Definition
(RefSeq) protein phosphatase 1, regulatory subunit 12C
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04510  Focal adhesion
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    232807 (Ppp1r12c)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    232807 (Ppp1r12c)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    232807 (Ppp1r12c)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    232807 (Ppp1r12c)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    232807 (Ppp1r12c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    232807 (Ppp1r12c)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     232807 (Ppp1r12c)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank
Other DBs
NCBI-GeneID: 232807
NCBI-ProteinID: NP_084110
MGI: 1924258
Ensembl: ENSMUSG00000019254
Vega: OTTMUSG00000024437
UniProt: Q3UMT1
Position
7; 7 A1
AA seq 782 aa
MSGEDGPAAGPGAAAAAAAARERRQEQLRQWGARAGADPGPGERRARTVRFERAAEFLAA
CAGGDLDEARLMLRAADPGPGSGAASDPAVPPPARAVLDSTNADGISALHQACIDENLEV
VRFLVEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAES
DAMEGLLKAEITRRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAA
KGYIEVMRLLLQAGYDTELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRP
CDLADEDVMNLLEELAQKQEDLRNQKEGSQGRGQESQVPSSSKHRRSSVCRLSSREKISL
QDLSKERRPGGAGGPPIGDEDEGGEASAEHPAVEPRALNGVSSPVSSNPKSPVLPEEAPF
SRRFGLQKTGSTGALGPSERRATEGVLGLQRSASSSLLEKASTQAREPRLARITPTPAQK
VPEPFTLYEAATPPSLDHSVPPSRREPGSIVKPNVLTASAAPLADSRDRRRSYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKVAGKVPEPEQPALPSLDPSRRPRVPGV
ENAEGPAQREAPEGQGQGPQAAREHRKAGHERRGPAEGEEAGPAERSPECSTVDGGSQVR
RQHSQRDLVLESKQEHEEPDGGFRKMYTELRRENERLREALTETTLRLAQLKVELERATQ
RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgtccggcgaggatggtccggcagcgggcccgggggcggcggcggctgctgcggccgcc
cgtgagcggcggcaggagcagctgcggcagtggggggctcgggcgggcgccgacccgggc
cccggggagcggcgagcccgcacggtccgcttcgagcgcgccgctgagttcctggcggcc
tgcgcggggggcgatctggacgaggctcgcctgatgctgcgcgcagcggatcccggtccc
ggctccggcgctgcgtccgaccccgccgtccctccgcctgcccgtgccgtgctcgactcc
accaacgcggatggcatcagcgccctgcaccaggcctgcatagatgagaacctggaagtc
gttcgcttcctggtggagcagggtgctactgtgaaccaggcagacaacgagggctggacg
cctctgcatgtggctgcctcctgtgggtacctggacattgccaggtacctcctgagccat
ggggccaacattgctgctgtcaacagtgacggggacctgcctttggacctggctgagtca
gatgccatggaggggctgctgaaggcagagatcactcgccgaggtgtggatgtcgaggca
gccaagcgggctgaagaagaattgctgcttcatgacacaaggtgctggctgaatgggggt
gctatgccagaggccaggcacccccggactggggcctctgccctgcatgtggctgctgcc
aagggctacatcgaggtgatgaggttgctactccaagctggctatgacacagagctccgg
gatggagatggctggacacccttgcatgcagcagcccactggggtgtggaggatgcctgc
cgtctgctggctgagcatggcgggggcatggattcgctgacccacgcggggcagcgtccc
tgtgacctggctgacgaggacgtgatgaaccttttggaggaactggctcagaaacaggag
gaccttcggaaccaaaaggaaggctcccagggccgaggccaggagtcacaggtcccttca
agtagtaagcacagaaggagctccgtgtgccgtttgagcagccgagagaagatctccttg
caggatctatcaaaggagcgccggcctggtggggcaggagggcctcctattggagatgag
gatgagggaggtgaagcgtcagctgagcacccagctgtggaaccaagagccctcaatggt
gtgtcttcccctgtgtcctccaaccctaagagccctgtgctgccagaagaggctcccttt
tccaggcgctttggtctccagaagacagggagcactggtgccttgggtccttcagaaagg
agggctacagagggcgttctcggtctgcagcgctcagcctcctcctccctccttgagaag
gcctccactcaggccagggagccccgtcttgccagaataacccctacccctgcccagaaa
gtgccagagcccttcaccctgtatgaggctgccacgcctccttctttggatcactctgtt
ccaccctccaggagggagcctggatcgatagtgaagccaaatgtcctcacagcctctgca
gcgcccctggccgactccagggaccgtcggaggtcctaccagatgcctgtgcgtgatgag
gagtccgagtctcagcggaaggcccgctcccgccttatgcgacagtctcggaggtccaca
cagggtgtaactctaacagacttgaaggaagcagaaaaggtggctgggaaggtcccagag
ccagagcagcctgccctacccagcctggacccttctcggagacctcgggtccctggagtg
gagaacgctgagggccctgcccagagagaggcgcccgaagggcagggccagggaccacag
gcggccagggagcatcgaaaagctggccatgagcggagggggccagcagagggggaagag
gcggggcctgcggaacggagcccagagtgcagcactgtggatggtggatcccaggtccgc
aggcagcactcacagagagacctcgttctagaatccaagcaggagcacgaggagcctgat
ggaggcttccggaagatgtacacggagctccgcagggagaatgagcgacttcgtgaggcc
ctgacagagaccaccctgcgtctggcacagctcaaggtggagctggagcgggccacgcag
cggcaggaacgctttgctgagaggcccgccctccttgaactggagagatttgagcgcagg
gctctggagcgcaaggcagcagagctggaagaggagctgaaggccctctctgatctccgg
gctgacaaccagcggctcaaggatgagaatgcagcattgatccgagtcatcagcaaacta
tccaagtga

KEGG   Mus musculus (mouse): 329251
Entry
329251            CDS       T01002                                 

Gene name
Ppp1r12b, 1810037O03Rik, 9530009M10Rik, AI132431, Mypt2
Definition
(RefSeq) protein phosphatase 1, regulatory subunit 12B
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04510  Focal adhesion
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    329251 (Ppp1r12b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    329251 (Ppp1r12b)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    329251 (Ppp1r12b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    329251 (Ppp1r12b)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    329251 (Ppp1r12b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    329251 (Ppp1r12b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     329251 (Ppp1r12b)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 PRKG1_interact Ank Ank_3
Other DBs
NCBI-GeneID: 329251
NCBI-ProteinID: NP_001074776
MGI: 1916417
Ensembl: ENSMUSG00000073557
Vega: OTTMUSG00000021600
UniProt: A6H644
Position
1; 1 E4
AA seq 992 aa
MAELEHLGGKRAESARARRAEQLRRWRGSLTEQEPAERQGAGRQLQTRRGSPRVRFEDGA
VFLAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFISHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGRIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQDVLRSEKETRNKLIESDLNSKFQSGLFKNKEKMLYEEEIPKSQDTEEENKESSSS
SSEEEEGEDEVSESETEKEADKKPEATVNHSNSEIKSRIMEQIPAPAQNTFSASSARRLS
SLFNKAEEPKDESPSSWRLGLRKTGSHNMLSEVANSREALRDRGSSIYRSSSSPRISALL
DDKDKERENKSYFSMLVPRRLSSTSDIEEKENRESAVNLVRSGSHTRQLWRDEAKGSETP
QTIAPSTYTSTYLKRTPYKSQADSTAEKTADSVSSSTPLCVITNRPAPSTANGVPAATVF
SSAGTDPSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAEKTF
SRSRAERQAQEQPGEKLEDPGGLEGSTKKQEPSAAPTKGAGEGRSLEEEPIYHRLRYPTQ
PDKPTTPVSPSASRPSLYTGSHLLRTSRASGPDSENSETSTHATAAKEMDTSEKGEADLD
DQSSNRLSVRERRRAKDRRRGTGINFWTNDEDETDVSEEVKEALHERLSRLESGGTNPTS
SDSYSDRASARARREAREARLASLTSRVEEDSNRDYKKLYESALTENQKLKTKLQEAQLE
LADIKAKLEKMAQQKQEKTSDRSSVLEVEKRERRALERKMSEMEEEMKNLHQLKQIQTLK
QMNEQLQAENRALTRVVARLSKSIESSDTQEL
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggcggagctggagcacctgggagggaagcgagcagagtcggcgcgagcgcggcgggct
gagcagctgcggcgctggcgaggctcgctgacagagcaggagcccgcggagcgacagggc
gcggggcgccagctgcagaccagacgcgggagccccagggtccgcttcgaagacggtgcg
gtctttctagctgcctgctccagcggggacacggacgaggtgaaaaagcttctggcaaga
ggtgcggacatcaacacggtcaacgtggacggcttgacagccctgcaccaggcctgtatt
gatgaaaatttggacatggtgaagtttctggtggagaacagagccaatgtaaaccagcag
gacaacgagggctggacacccctgcatgcagcagcttcctgtggttatctcaacatagca
gagtattttattagccatggagccagtgtgggtattgtgaacagtgaaggtgaagttcct
tctgaccttgcagaggagccagccatgaaagaccttcttctggaacaagtaaagaaacaa
ggcgttgatctagagcagtcaaggaaggaggaagaacagcagatgttgcaggatgcccgc
cagtggctcaacagcggaagaatagaagatgtgaggcaggctcgctcaggggccactgcc
ctgcatgtagctgctgccaagggttactctgaagtcctcaggcttctcattcaggctggc
tatgaactcaatgttcaggatcatgacggctggactcctcttcatgcagctgcacactgg
ggagtaaaagaggcttgctccatcctggcagaagcactctgtgacatggatatccggaac
aaactgggccagacgccatttgatgtggctgatgaaggtctcgtggagcacttggagatg
cttcagaagaagcaagatgtgcttcgaagtgaaaaggagacacggaataagctcatcgag
tcagacctgaatagcaagtttcagagtggactctttaagaacaaagagaagatgctttat
gaagaagagatcccgaagtcccaagacacagaggaagaaaacaaagagtccagcagctcc
agctcagaggaggaggaaggggaagatgaagtttctgaatcagagactgagaaggaggca
gataaaaagccagaagccactgtcaaccattccaactctgaaatcaagagtcggatcatg
gagcagatcccagccccagctcagaacaccttctctgcctcttcagctaggagactgtcc
agtcttttcaacaaggcagaagagcctaaagatgaatctccctcttcctggagactgggg
ctcagaaaaactggtagccacaatatgctgagtgaagtggccaattccagggaggccctt
agggatcgaggttcttccatctaccggtcctcctcaagccctcggatctctgctttgctg
gatgacaaagataaggaaagagaaaacaaaagctatttcagtatgctagtaccccggagg
ctcagcagcacaagtgacattgaagaaaaggagaacagagagtcagctgttaatctagta
aggagtggctcccataccaggcagctgtggagggatgaagcaaagggaagtgaaacccca
cagacaatcgctccttccacttacacgtcaacttacttgaaaaggactccttacaagtcc
caggctgactcaacagcagagaaaacagcagacagtgtctcctccagcaccccactgtgt
gtgatcaccaaccgtcctgcgccaagtactgccaatggggttccagctgccacagtgttc
tcctccgctggaacagacccctctgtggaggcccgggagaagaggaggtcttatctaact
cctgtacgggatgaggaggcagagtcattacggaaagcacgctccagacaagctcggcag
acgcgaaggtctactcaaggtgttaccctaacagacctccaagaagcagaaaagactttc
agccgttcgagggcagagagacaagcccaggagcagcctggggagaagcttgaagatcct
ggtggcctcgaaggaagcaccaagaagcaggagccatcggcagccccaacaaagggagct
ggcgagggcagaagtctggaggaagagcctatctatcatcgcctaaggtatccaactcaa
ccagacaaacccacgacaccagtttctccttctgcatcaagaccctcactctacactggc
tctcatctactgcgcacaagcagagcttcaggccctgactctgagaattcagagactagc
acacacgccacagcggcaaaggaaatggacacgagtgagaaaggagaagctgatttggat
gatcagtcctctaacaggctgtctgtccgggaacggagaagagctaaagataggcgaaga
ggcaccggcattaacttctggacaaatgacgaagatgaaacagatgtctctgaagaggtc
aaagaagctttgcatgaaagactttctaggttggagtcaggaggcaccaatccgaccagc
agcgattcttacagtgaccgtgcctcagcaagagcccgtcgggaggccagggaggctcgt
ctagccagcctgaccagccgggtagaagaggacagcaacagggattataagaaactctac
gagagtgccctgaccgaaaaccaaaagctgaaaacaaagcttcaggaggcccagctagag
cttgccgatataaaagccaagcttgagaagatggcccagcagaaacaagagaagacctct
gaccggtcctcggtgctggaggtggagaagcgggagaggcgagcactggaacggaaaatg
tcggaaatggaagaagagatgaagaaccttcaccagctaaaacagattcaaaccttgaag
cagatgaacgaacaactgcaggctgagaacagggccctgacccgagtggtggccagactc
tccaagtccatcgagtcctccgacacccaggagctctag

KEGG   Mus musculus (mouse): 434233
Entry
434233            CDS       T01002                                 

Gene name
Ppp1ccb, EG434233, Gm5601, PP-1G, Ppp1cc
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma B
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04720  Long-term potentiation
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04931  Insulin resistance
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05168  Herpes simplex virus 1 infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    434233 (Ppp1ccb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    434233 (Ppp1ccb)
   04024 cAMP signaling pathway
    434233 (Ppp1ccb)
   04022 cGMP-PKG signaling pathway
    434233 (Ppp1ccb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    434233 (Ppp1ccb)
   04218 Cellular senescence
    434233 (Ppp1ccb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    434233 (Ppp1ccb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    434233 (Ppp1ccb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    434233 (Ppp1ccb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    434233 (Ppp1ccb)
   04921 Oxytocin signaling pathway
    434233 (Ppp1ccb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    434233 (Ppp1ccb)
   04270 Vascular smooth muscle contraction
    434233 (Ppp1ccb)
  09156 Nervous system
   04728 Dopaminergic synapse
    434233 (Ppp1ccb)
   04720 Long-term potentiation
    434233 (Ppp1ccb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    434233 (Ppp1ccb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    434233 (Ppp1ccb)
  09165 Substance dependence
   05031 Amphetamine addiction
    434233 (Ppp1ccb)
   05034 Alcoholism
    434233 (Ppp1ccb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    434233 (Ppp1ccb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    434233 (Ppp1ccb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    434233 (Ppp1ccb)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    434233 (Ppp1ccb)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    434233 (Ppp1ccb)
   03041 Spliceosome [BR:mmu03041]
    434233 (Ppp1ccb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     434233 (Ppp1ccb)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     434233 (Ppp1ccb)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     434233 (Ppp1ccb)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     434233 (Ppp1ccb)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    434233 (Ppp1ccb)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 434233
NCBI-ProteinID: NP_001357876
MGI: 3647492
Ensembl: ENSMUSG00000100153
Structure
PDB: 
4V0W 4V0V 4V0X

Position
7; 7 F2
AA seq 337 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVGSGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggatatcgacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagccaggcaagaatgtccagctccaggagaacgagatccgaggactctgcctg
aagtctcgggagatcttcctcagtcagcctatccttttagaacttgaagcaccactcaag
atatgtggtgacatccacgggcagtactatgatttgctccgtctgtttgaatacggtggc
tttcctccagagagcaactatttgtttctcggggactatgtggacaggggcaagcagtcc
ctggagacaatctgcctcttgctggcctacaaaatcaagtatccggagaacttctttctt
ctcagagggaaccacgagtgcgccagcatcaataggatctacggattttatgatgagtgt
aaaagaagatacaacattaagctgtggaaaacgttcacagactgttttaactgcttgccg
atagcagccatcgtggacgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgagaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggctatgagttttttgcaaag
aggcagttagtcactctgttttctgcacccaactactgtggcgagtttgacaatgcaggc
gccatgatgagtgtggatgagaccctcatgtgttccttccagattttaaagcctgcagag
aaaaagaagcccaacgccacgagacctgtcacaccaccacgggttggatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaacactgtcctatacgagtga

DBGET integrated database retrieval system