KEGG   Mus musculus (mouse): 17937
Entry
17937             CDS       T01002                                 

Gene name
Nab2, AI451907
Definition
(RefSeq) Ngfi-A binding protein 2
  KO
K22388  NGFI-A-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    17937 (Nab2)
SSDB
Motif
Pfam: NCD2 NCD1
Other DBs
NCBI-GeneID: 17937
NCBI-ProteinID: NP_032694
MGI: 107563
Ensembl: ENSMUSG00000025402
Vega: OTTMUSG00000031880
UniProt: Q61127
Position
10 D3; 10 74.6 cM
AA seq 525 aa
MHRAPSPTAEQPPGRGDNTRRTPQPRFKASAPAMALPRTLGELQLYRVLQRANLLSYYET
FIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAV
PVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAG
DPRIWPGQSTPESDVGAGGEEEAGSPPFSPPAGGGVSEGPGVGGVAAGGAGGGPDRLEPE
MVRMVVESVERIFRSFPRGDTGEIASLLKLNKKLARSVGHIFEMDDHDAQKEEEIRKYSV
IYGRLDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTYLSSL
KGSRLHSEELGGPPLKKLKQEVGEQSHNEIQQPPPGPESYAPPYRPSLEEDSASLSGESL
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSP
CVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcacagagctccctctcccacagcggaacagccacctggcagaggggataacacacgc
cggaccccgcaacccagattcaaggcaagtgccccagccatggcactgcctcggacactg
ggtgagctacagctgtatcgggtcctgcaacgcgccaacctcctctcttactacgagacc
ttcatccagcagggaggagatgatgtacagcagctgtgtgaggctggcgaggaggagttc
ctggaaatcatggcactcgtgggcatggccaccaaaccactccatgtccgacgtctacag
aaggctctgagagaatgggccaccaatccagggctcttcagccaaccagtgcctgctgtg
cccgtctccagcatcccacttttcaagatctctgagacagctggtacccggaaagggagc
atgagcaatgggcacggcagcccaggagaaaaggcgggcagtgctcgaagctttagcccc
aagagtcccctcgaacttggagagaagttgtcgccactccctggaggacctggggcaggg
gatccccggatctggccaggccagagcactccagaatctgatgttggagcagggggagaa
gaggaggccgggtctccccctttctccccacctgcagggggaggagtctctgaagggcct
ggggttgggggggtggcagctggtggtgcagggggtggtccagaccgcctggaaccagag
atggtgcgaatggtggtggagagtgtggagaggatcttccggagtttccccaggggtgac
actggagagatcgcatccctgttgaagctgaataagaagctggcgcggagcgtggggcac
atctttgagatggacgatcatgacgcccagaaggaagaggagatccggaagtacagcgtc
atctacggccgcctggactccaaaaggcgggagggcaaacagcttagcttgcatgagctg
accatcaacgaggctgctgcccagttctgcatgagggacaacactcttttactgcgaagg
gtagaactcttctcactgtcccgacaagtagcccgagagagcacctatctttcttccttg
aagggatccaggcttcactctgaagaattgggaggcccaccactgaagaaactgaaacaa
gaggttggagaacagagtcacaatgaaatccagcagcctcctccaggccctgagtcctat
gcacccccataccgccccagcctagaggaggacagcgccagtctgtctggggagagcctg
gatggccacttgcaggctgtggggtcgtgcccaaggctgacgccgccccctgctgacctg
cccctggcattgccagcgcatgggctatggagccgccacatcttgcagcagacactgatg
gatgaggggctgcggctcgcccgcctcgtctcccatgatcgtgtgggccgcctcagcccc
tgtgtgcctgcgaagccgcctctcgcagagttcgaggaggggttgctggaccgctgccct
gccccgggacctcatcctgctctggtggagggccgcaggagcagcgttaaagtggaggca
gaagccagccggcagtga

DBGET integrated database retrieval system