KEGG   Mus musculus (mouse): 17938
Entry
17938             CDS       T01002                                 

Gene name
Naca, AL022831, AL024382, D12Mgi4, Gm1878, mKIAA0363, sk, skNAC
Definition
(RefSeq) nascent polypeptide-associated complex alpha polypeptide
  KO
K03626  nascent polypeptide-associated complex subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    17938 (Naca)
SSDB
Motif
Pfam: NAC HYPK_UBA
Other DBs
NCBI-GeneID: 17938
NCBI-ProteinID: NP_001106670
MGI: 106095
Ensembl: ENSMUSG00000061315
UniProt: P70670
Position
10; 10 D3
AA seq 2187 aa
MPGEATETVPATEQELPQPQAETAVLPMSSALKVAAVGQPGPTPPSSLGPQQSPIVTAHQ
PSPLPSSVSSTPFEVPFAQPITAETALPSGTAPPTPTFLPHLIGPPISPAALALASPMIG
LAQKGARSSSAPLSLVALAPHSVQKSSVCPPHPLTSPPSAAGAELGALTASIPPLEPKTS
TSQVPSQGTLNLKGTAPCPPDVVRAFPSHLENPLASVQPGLMSCPQTLSNTSPVKGVPIS
SALTQSRLSLNLKGPVSPPARNTAAPSIPLAPSTSLGCHLPLLHHSSVDSPIQPPGQSGL
AVSNPTSVGHSGIAASCPPERCVVPALPSRLLAVDSGAAPSDDKGSSAVTNELCSPPGSS
NVAGTSLSPKASLVPKGSNVALQPLVTQVPASQKTGLKEIPVSCIGATHHALDNPSAISV
APATHVPPPTSSGLVSSKDPASPVTSLVVPAAHKQFPAPPASATLGVPVSPLPATEGLKN
LPISALVNVGAPVSPAQAGLPTRKDTTLQPLAPIALKESPSSQSASSLEVLSEDTVTKKT
TGGPAPVVRPAIAGVATTTSLRADSPPAVIRADSCVSPNTVSQPLKRSVTDPAMAPRTAK
NTAPSTTSPLVPLASEGCPVASSMALSPQNASVSETALALSPEIPKSVPFPDPPLAEISF
SNARKVDAVSHMESSGSSRQGHPDASVTAKGTVVCLADSSLDTSVSASKGSALSGASSPL
YPLEVSFLPEAGLAVQGPKGSLNKLSPTPPSSKGAPVPSTGAPPSPKGAPIVPTESSISS
KQVPAEILPSPQKTPEVTASRLISAVQSPKVDPIMSDVTPTSPKKTSATAVPKDTSATLS
LKSVPAVTSLSPPKAPVAPSNEATIVPTEIPTSLKNALAAATPKETLATSIPKVTSPSPQ
KTPKSVSLKGAPAMTSKKATEIAASKDVSPSQFPKEVPLLPHVPPTSPPKSPVSDTLSGA
LTSPPPKGPPATLAETPTYPKKSPKPAASKKTPATPSPEGVTAVPLEIPPCSKKAPKTAA
PKESSATSSSKRAPKTAVSKEIPSKGVTAVPLEISLPLKETSKSATPGEKSASSPKRSPK
TAGPKETPPGGVTAVPPEISLPPKETPQNATPNESLAASSQKRSPKTSVPKETPPGGVTA
MPLEIPSAPQKAPKTAVPKQIPTPEDAVTILAGSPLSPKKASKTAAPKEAPATPSVGVIA
VSGEISPSPKKTSKTAAPKENSATLPPKRSPKTAAPKETPATSSEGVTAVPSEISPSPPT
PASKGVPVTLTPKGAPNALAESPASPKKVPKTAAPEETSTTPSPQKIPKVAGPKEASATP
PSKKTPKTAVPKETSAPSEGVTAVPLEIPPSPRKAPKTAAPKETPAPSPEGATTAPVQIP
PSPRKGSKKAGSKETPTTPSPEGVTAAPLEIPISSKKTSKMASPKETLVTPSSKKLSQTV
GPKETSLEGATAVPLEIPPSHKKAPKTVDPKQVPLTPSPKDAPTTLAESPSSPKKAPKTA
APPSERVTTVPPEKPATPQKASATTASKVPVPAETQEVAVSSRETPVTPAVPPVKNPSSH
KKTSKTIELKEAPATLPPSPTKSPKIPSSKKAPRTSAPKEFPASPSIKPVTTSLAQTAPP
SLQKAPSTTIPKENLAAPAVLPVSSKSPAAPAAASASLSPATAAPQTAPKEATTIPSCKK
AAATETPIETSTAPSLEGAPKETSETSVSKVLMSSPPKKASSSKRASTLPATTLPSLKEA
SVLSPTATSSGKDSHISPVSDACSTGTTTPQASEKLPSKKGPTAFTEMLAAPAPESALAI
TAPIQKSPGANSNSASSPKCPDPSSKKDTKGLPSAVALAPQTVPVEKDTSKAIETLLVSP
AKGSDCLHSPKGPVGSQVATPLAAFTSDKVPPEAVSASVAPKPAPAASLTLAPSPVAPLP
PKQPLLESAPGSVLESPSKLPVPAEEDELPPLIPPEAVSGGEPFQPILVNMPAPKPAGTP
APAPSAKQPVLKNNKGSGTESDSDESVPELEEQDSTQTATQQAQLAAAAEIDEEPVSKAK
QSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKI
EDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQA
NVSRAKAVRALKNNSNDIVNAIMELTM
NT seq 6564 nt   +upstreamnt  +downstreamnt
atgcccggtgaagccacagaaaccgtccctgctacagagcaggagttgccacagcctcag
gctgagacagctgtgcttcctatgtcttcagccttgaaagttgctgctgtagggcagcct
ggacctacccctccttcttccctgggcccccagcaaagccctatagtaactgctcatcag
ccttctccactcccttctagtgtttcctcgaccccctttgaagttccttttgcccagccc
ataacagctgaaactgctctgccctcaggaactgcccctcccaccccaactttcctgcca
cacctgatagggcctcccatttccccagctgcgctagccttggcctctcccatgataggt
ctagctcagaaaggtgccaggtcctcctcggctcccttgtctctggtcgcattagctcct
cattcggttcagaagagctctgtatgtccccctcaccctctcacctcacctccatcagct
gctggagcagagttgggggcattgacagcttccatccctcccttagaaccaaagacttct
accagtcaagttccctctcagggaaccctgaatctaaaaggcactgccccgtgtcctcca
gatgtagtcagggcttttccttcccaccttgaaaaccccctggcctctgttcagcctggt
ttaatgtcctgtcctcaaacactatccaacacttccccagtgaaaggtgtccccatttcc
tcagctctgacacaaagtcggctaagccttaacctaaagggacctgttagtccacctgct
cgtaacactgcagctcccagcatccccctagcaccctctacttctctgggctgtcatctt
ccacttctgcatcacagttctgtggattctcccatccagcctccaggtcagtcagggctt
gcagtgagtaatcccacttctgtaggtcactctggtattgcagcctcttgcccacctgag
agatgtgtagttcctgcccttccctccaggctgctggctgttgattctggggcagctcca
tctgacgacaaaggctcctctgctgttactaatgagctctgcagccctcctggctcttca
aatgtagctggtacttccttgtctcctaaagcctctctcgttcccaaaggttctaatgtt
gctctacagcctttggtgactcaagttcccgcttctcaaaaaactggtttaaaagaaatt
cctgtctcctgtattggagccacccaccatgccctggataacccttctgccatttctgta
gcacctgccactcatgtgcctcctccaacttcatcaggtcttgtgagtagtaaagaccca
gcttcccctgtcacgtcactcgtcgtacctgctgctcacaagcagtttcctgctcctcca
gcatcagctactctaggggtgccagtgtctcctctgccagccactgaaggccttaaaaat
cttcctatttcggcattagtaaatgtaggcgcccctgtttctccagcccaggcagggctc
cctaccagaaaagacactactctgcagcccttggcccccatagcacttaaagagtctccc
tcttctcagagtgcatcatctctggaggtactttcagaagacactgtaacaaagaagact
acaggaggacctgcccctgtagtgcggccagccattgctggggttgctactactacttcc
ctgcgtgctgactctccacctgctgtcatcagggcagattcttgtgtcagcccaaacact
gtcagtcagcctctcaaacgttctgttactgacccagcaatggctcctagaactgccaaa
aatactgctccttctaccacttcacctttggttcctttagcctctgaaggctgtcctgtg
gcttcatctatggctttgtccccccagaatgcttctgtttctgagactgctttggcattg
tcccctgaaattcccaagtctgtgccctttcctgatcctcccttagctgagatttctttt
tccaatgcaaggaaagttgatgctgtctctcatatggagtcttcaggctcctctcgtcag
gggcacccagatgcttctgtgactgccaaagggactgtggtttgtctagctgactcatct
ttagacactagtgtgtctgcatccaagggctctgctctctcaggtgcttcgtctcctctc
tacccacttgaggtttctttccttccagaggcaggtctggctgttcaaggccctaaaggc
tcacttaataagctttctcccactcctccatcctccaaaggggcccctgttccttcaact
ggggctcctccctcccctaaaggagcccctattgttccaacagaaagttctatatcctcc
aaacaggtcccagcagaaattcttccttccccccaaaagaccccagaagttacagcttcc
agactgatctcagcagtccagtctcctaaagtagaccctattatgtcagacgtgacccct
acctctcccaaaaagacttcagcaactgcagtccccaaagatacttcagcaaccctgtct
ctcaaaagtgtcccggctgtgacttccctgtctcccccaaaggcccctgtagccccatct
aatgaagccaccattgttcctactgagattcctacctccctcaaaaatgccctagcagct
gcaactcccaaagagactttagcaacctcaattcccaaagtgacttctccttccccacaa
aagactccaaaatccgtatcccttaagggtgccccggctatgacctccaaaaaggcgaca
gaaattgcagcctccaaagacgtctcaccatcccagtttcccaaagaggttcctcttcta
ccacatgtgcctcctacttccccaccaaagtccccagtaagtgatacactcagtggggct
ctaacaagcccaccccccaaaggtccccctgccaccctagctgagactcctacctatcct
aaaaagtcccctaaacctgcagcatccaaaaaaactccagcgactccatctcctgaaggg
gtcacagctgttccactggagattcctccttgctccaaaaaggcccccaaaactgcagct
cccaaagaaagttcagcaacctcatcttctaaaagggcccctaaaactgcagtttccaaa
gaaattccttctaaaggggtcacagctgtgccattggagatttctctgcctctaaaagaa
acctccaaaagtgcaactcctggagaaaagtcagcctcatccccaaaaaggtcccccaaa
actgcaggccccaaagaaactccacctggaggggttacagctgtgcccccggagatttct
ctacctccaaaagagacaccccagaatgcaacccctaatgaaagtttagcagcctcatcc
caaaaaaggtcccccaaaacttcagtccccaaagaaactccacctggaggggtcacagct
atgccactggaaattccttctgccccccaaaaggcccccaaaactgcagtccctaaacag
attcctactcccgaagatgctgttactatcctagctggaagtcctctctctcccaaaaag
gcatccaaaaccgcagcccccaaagaagctccggcaaccccatctgtgggggtcatagct
gtatcaggagagatttctccctcccccaaaaagacctcaaaaactgcagcccccaaagag
aattcagcaaccttacccccaaaaaggtcccccaaaactgcagcccccaaagagactcca
gccacatcttctgaaggggttacagctgtgccatctgagatttctccttcacccccaact
ccagcctccaaaggggttcctgtgaccctaactcccaaaggtgcccctaatgccctagct
gagagtcctgcctcccctaaaaaggtccctaaaactgcagcccctgaagaaacctcaaca
accccatccccccaaaaaattcccaaagtggcaggtcccaaagaggcttcagcaacccca
ccttcaaaaaagacccccaaaactgcagtccccaaagaaacttcagcaccttctgagggg
gtcacagctgtaccactggaaattcctccctcccccagaaaggcccctaaaactgcagct
cccaaagaaactccagccccgtctcctgaaggggccaccactgcaccagtgcagattcct
ccctcccccaggaagggctctaagaaagcaggctccaaagaaacacctacaaccccatct
cctgaaggggtaacagctgcacctctagaaattcccatatcttccaaaaagacttccaaa
atggcaagtcctaaagaaacgctagtaaccccatcttccaaaaagctctcccaaactgta
ggtcccaaagaaacttcacttgaaggggccacagctgtgccactggagattcctccttcc
cacaaaaaggcccccaaaactgtagatcctaaacaggttcctctaaccccatctcctaaa
gatgcccctactactctagctgaaagtccttcctcccccaaaaaggcacccaaaactgca
gccccaccctctgaaagggtcaccactgtgccaccagagaagcctgccaccccacagaag
gcctcagcaactacagcctccaaagtgcctgtccctgccgagacacaggaagttgctgtc
tcctcaagagagactccagtaaccccagctgtgcccccagtcaagaatccttcctcccat
aagaagacctcaaagactatagagctcaaagaagccccagcaaccctccctccctcccca
acaaagagccccaaaattccatcatccaaaaaggcaccaaggacttcagcccctaaagag
tttccagcaagcccttctattaaacctgtcaccacctcactggcacagacagctcctccc
agtctgcaaaaggcaccatcgactacaatccccaaggagaatttagctgccccggctgtt
ctgcctgtctccagcaagagcccagcagctccagctgctgcaagtgcttccctttcccca
gctactgcagctcctcaaacagctccaaaagaggccacaacaatcccatcttgtaaaaag
gctgcagctactgagacccccattgagacttcaacagctccatctctcgagggggccccc
aaggagacctcagaaacttcagtgtccaaagttctcatgtcttcccctcccaaaaaggct
tcatcctccaaaagagcctccactctcccagctacaactcttccctctcttaaagaggcc
tctgttctctcacccactgccacttcttccggaaaagactctcatatttccccagtgtcc
gatgcttgtagcacaggaactactacccctcaggcatctgaaaagctcccatcaaagaaa
ggtcctacagctttcacggaaatgcttgctgcacctgctccagaaagtgctttggccatc
actgctcccattcagaaaagcccaggggccaacagcaattctgcttcctctcctaagtgc
ccagacccctcctctaagaaagacacaaagggcctcccttctgcagtagctctagcccct
cagacagttcctgttgagaaagacacttcaaaagctatagaaactctgcttgttagccct
gcaaaaggcagtgattgtcttcattccccaaagggtcctgtggggtctcaggtagctact
ccactagcagcgtttacctctgacaaagtccctccggaagctgtgtctgcatctgtggct
ccaaagcctgccccagcagcttccctgactcttgctccctccccagttgcccctctgcct
cctaaacagccacttcttgagtctgcacctgggtcggtgctggagtccccctctaagctc
ccagtccctgctgaggaggatgagctgccgcctctgattcccccggaagcagtctctggg
ggagagcctttccagccgatcctcgtcaacatgcccgcccctaaacctgctgggacccct
gccccagccccctctgccaagcagcctgttctgaagaacaacaagggatcgggaacagag
tctgacagtgatgagtcagtaccagagctcgaggaacaagactccacacagacggccacg
cagcaagcccagctggcagccgcagcagagatcgatgaagaacctgttagtaaagccaag
cagagtcgaagtgagaagaaggcaaggaaggctatgtccaaactgggtcttcgacaggtt
acaggggttacgagagtcactatccgaaaatctaaaaatatcctctttgtcatcacaaaa
cccgatgtctacaagagcccagcttcagacacctacatagtgtttggggaagccaagatt
gaagatttgtctcagcaagcacagttagcagctgctgagaaattcaaagttcaaggtgaa
gctgtttcaaacattcaggaaaacactcagactccaaccgtccaagaggagagtgaagaa
gaggaggttgatgagacgggtgtggaagttaaggacatagaactggtcatgtcgcaagca
aacgtatcaagagcaaaggctgttcgagccctgaaaaacaacagtaatgatattgtaaat
gctattatggaattaacaatgtaa

DBGET integrated database retrieval system