KEGG   Mus musculus (mouse): 17939Help
Entry
17939             CDS       T01002                                 

Gene name
Naga
Definition
(RefSeq) N-acetyl galactosaminidase, alpha
  KO
K01204  alpha-N-acetylgalactosaminidase [EC:3.2.1.49]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mmu01100  Metabolic pathways
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    17939 (Naga)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    17939 (Naga)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.49  alpha-N-acetylgalactosaminidase
     17939 (Naga)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase SAND
Motif
Other DBs
NCBI-GeneID: 17939
NCBI-ProteinID: NP_032695
MGI: 1261422
Ensembl: ENSMUSG00000022453
UniProt: Q9QWR8 Q3U6T2
Position
15 E1; 15 38.56 cM
AA seq 415 aa AA seqDB search
MLQKTVLLLALVAQVLMLENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMAD
RLAQDGWRDLGYVYLNIDDCWIGGRDASGRLIPDPKRFPHGIAFLADYAHSLGLKLGIYE
DMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERAEGYPKMAAALNATG
RPIAFSCSWPAYEGGLPPKVNYTEVSRVCNLWRNYKDIQDSWKSVLSILDWFVRHQDVLQ
PVAGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLLMSTDLRTISPQNMDILQNP
LMIKINQDPLGIQGRRILKSKSHIEVFKRYLSNQASALVFFSRRTDMPFRFHCSLLELNY
PKGRVYEGQNVFTGDIFSGLQTEVNFTVIINPSGVVMWYLYPIKDLGISTMMSHW
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagaagacagtgctcttactggccctggtggctcaggtactgatgctggagaat
gggctactgcggactccacccatgggctggctggcctgggaacgcttccgctgtaacatc
gactgtgtggaggacccgaagaactgcatcagtgaacggctctttatggagatggcggac
agactggcccaggatggatggcgggacctgggctatgtatacctcaacatcgatgactgc
tggattggtgggcgtgacgcctcaggccgcctaattcctgatcccaagcgcttccctcac
gggattgccttcctagctgactatgctcactctttgggtctgaagctgggcatctatgag
gacatgggcaaaatgacctgcatgggttaccctggtaccaccctagacaaagtggagctg
gacgcggaaaccttcgcggagtggaaggtggacatgctgaagttggatggctgtttctcc
agctccagagaacgtgcagaggggtaccccaagatggctgctgccctgaacgccacgggc
cgtcccattgccttttcttgcagctggccagcctatgaagggggcctaccccccaaggtg
aactacaccgaggtttccagggtctgcaatctctggcgcaactataaagacatccaggac
tcctggaagagtgtgctgtccatcctggactggtttgtgagacaccaggatgtactgcag
ccggtggcgggtcctgggcactggaatgacccagacatgctgctcatcgggaactttggc
ctgagcttcgatgaatcccgggcacaaatggccctgtggacagtgctcgcagcccccctc
ctcatgtccacggacctgcgtaccatctcccctcagaatatggacattcttcagaaccca
ctcatgatcaaaatcaatcaggaccccttaggcatccagggacgcaggatcttaaagagc
aaatcccatatcgaagtgttcaagaggtatctgtctaaccaggccagtgccctggttttc
ttcagccgcaggacagacatgcctttccgctttcattgctccctcttggaactaaactac
cccaaaggcagagtgtatgagggccagaacgtcttcacaggagatatcttcagtggtctc
cagactgaagtcaacttcactgtgatcatcaatccttcgggggttgtgatgtggtacctc
tatcccatcaaagacctggggatatccacgatgatgtcccactggtga

DBGET integrated database retrieval system