KEGG   Mus musculus (house mouse): 17951
Entry
17951             CDS       T01002                                 
Symbol
Naip5, Birc1e, Lgn1, Naip-rs3
Name
(RefSeq) NLR family, apoptosis inhibitory protein 5
  KO
K12807  baculoviral IAP repeat-containing protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    17951 (Naip5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    17951 (Naip5)
   05134 Legionellosis
    17951 (Naip5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17951 (Naip5)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    17951 (Naip5)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I32: IAP family
   17951 (Naip5)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   17951 (Naip5)
SSDB
Motif
Pfam: BIR NLRC4_HD NACHT NOD2_WH AAA_30 LRR_4 AAA_22 T2SSE TsaE DUF6195
Other DBs
NCBI-GeneID: 17951
NCBI-ProteinID: NP_035000
MGI: 1298220
Ensembl: ENSMUSG00000071203
UniProt: Q9R016
Structure
Position
13:complement(100348243..100387437)
AA seq 1403 aa
MAEHGESSEDRISEIDYEFLPELSALLGVDAFQVAKSQEEEEHKERMKMKKGFNSQMRSE
AKRLKTFETYDTFRSWTPQEMAAAGFYHTGVRLGVQCFCCSLILFGNSLRKLPIERHKKL
RPECEFLQGKDVGNIGKYDIRVKRPEKMLRGGKARYHEEEARLESFEDWPFYAHGTSPRV
LSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSEEIAQYI
QSYEGFVHVTGEHFVKSWVRRELPMVSAYCNDSVFANEELRMDMFKDWPQESPVGVEALV
RAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSAEVIPTLQS
QYALPEATETTRESNHGDAAAVHSTVVDLGRSEAQWFQEARSLSEQLRDNYTKATFRHMN
LPEVCSSLGTDHLLSCDVSIISKHISQPVQEALTIPEVFSNLNSVMCVEGETGSGKTTFL
KRIAFLWASGCCPLLYRFQLVFYLSLSSITPDQGLANIICAQLLGAGGCISEVCLSSSIQ
QLQHQVLFLLDDYSGLASLPQALHTLITKNYLSRTCLLIAVHTNRVRDIRLYLGTSLEIQ
EFPFYNTVSVLRKFFSHDIICVEKLIIYFIDNKDLQGVYKTPLFVAAVCTDWIQNASAQD
KFQDVTLFQSYMQYLSLKYKATAEPLQATVSSCGQLALTGLFSSCFEFNSDDLAEAGVDE
DEKLTTLLMSKFTAQRLRPVYRFLGPLFQEFLAAVRLTELLSSDRQEDQDLGLYYLRQID
SPLKAINSFNIFLYYVSSHSSSKAAPTVVSHLLQLVDEKESLENMSENEDYMKLHPQTFL
WFQFVRGLWLVSPESSSSFVSEHLLRLALIFAYESNTVAECSPFILQFLRGKTLALRVLN
LQYFRDHPESLLLLRSLKVSINGNKMSSYVDYSFKTYFENLQPPAIDEEYTSAFEHISEW
RRNFAQDEEIIKNYENIRPRALPDISEGYWKLSPKPCKIPKLEVQVNNTDAADQALLQVL
MEVFSASQSIEFRLFNSSGFLESICPALELSKASVTKCSMSRLELSRAEQELLLTLPALQ
SLEVSETNQLPEQLFHNLHKFLGLKELCVRLDGKPNVLSVLPREFPNLLHMEKLSIQTST
ESDLSKLVKFIQNFPNLHVFHLKCDFLSNCESLMAVLASCKKLREIEFSGRCFEAMTFVN
ILPNFVSLKILNLKDQQFPDKETSEKFAQALGSLRNLEELLVPTGDGIHQVAKLIVRQCL
QLPCLRVLTFHDILDDDSVIEIARAATSGGFQKLENLDISMNHKITEEGYRNFFQALDNL
PNLQELNICRNIPGRIQVQATTVKALGQCVSRLPSLIRLHMLSWLLDEEDMKVINDVKER
HPQSKRLIIFWKLIVPFSPVILE
NT seq 4212 nt   +upstreamnt  +downstreamnt
atggctgagcatggggagtcctccgaggatcggatttctgagattgattatgaatttctc
cccgagctctctgctcttctcggggtggatgcatttcaggtggcaaagagccaagaagaa
gaagagcataaagaacggatgaaaatgaagaaaggttttaactcacagatgcgcagtgaa
gccaaacgactaaagacctttgagacctatgacacgttcagatcatggacgccacaggag
atggcagctgctgggttttaccacacaggggtgagacttggcgttcagtgcttttgctgt
agcttgatcctctttggtaacagcctcaggaagcttcccatagagagacacaagaaatta
cgtccggaatgtgagttccttcagggcaaagatgttggtaacattggcaagtatgacatc
cgggtgaagaggccagagaagatgctgagaggtggcaaagccaggtaccatgaagaggag
gccagactggagtcctttgaggactggccattttatgcccatgggacatcaccacgtgta
ctctcagcagctggctttgtctttacaggtaaaagggacactgtgcagtgtttctcctgt
ggcggaagcttgggcaactgggaagaaggagatgacccctggaaggagcatgccaagtgg
ttccccaaatgtgaatttcttcaaagtaagaaatcctcagaggaaattgcccagtatatt
caaagctacgagggatttgttcatgtaacgggagaacattttgtgaagtcctgggtcaga
agagaattacctatggtatcagcttactgcaatgacagtgtcttcgctaatgaagaacta
aggatggacatgtttaaggactggccccaagaatcacctgtgggtgttgaagctctagtc
agagcaggctttttctacactggcaaaaaggacattgtccggtgtttttcctgtggagga
tgtttggaaaagtgggcagaaggtgacgacccaatggaagatcacatcaagttttttccc
gaatgtgtatttcttcaaaccttgaagtcctctgcagaagtaattccaacccttcagagc
caatatgcacttccagaagccacggaaaccacacgtgaaagcaaccatggtgatgcagca
gcagttcattctacagtggtggacttgggtaggagtgaagcccagtggtttcaagaggcc
aggagtctgagtgagcagctaagagacaactacactaaagccactttccgccacatgaac
ttgccagaagtgtgctccagccttggcactgaccacttgctcagctgcgatgtgtccatc
atttcaaagcacatcagccagcctgtgcaagaggccctgacgatccccgaggtcttctcc
aatctcaactctgtcatgtgtgtggagggggaaactggcagtggaaagacaaccttcctg
aagaggatagcttttctctgggcatcaggatgctgccccctgttgtacaggttccagctg
gtcttctatctctcccttagttccatcacaccagatcagggactggccaacatcatctgt
gcccaactcctaggggcaggaggttgcattagtgaagtgtgtctgagcagcagcatccag
cagttacaacaccaggtgctgttcctgttggatgactacagtgggctggcctcactcccc
caagccctacacacactgattacaaaaaactacttgtcacggacctgcttattgatcgct
gtgcatacaaacagggtcagagacatccgcctatacctaggtacaagtctagagatccaa
gagtttcccttctataatactgtctctgtattacggaagtttttttcacatgacataatc
tgtgtggaaaagcttataatttactttattgataataaagatttacagggagtttacaag
acccctctctttgtagcagcagtatgtactgactggattcaaaatgcatctgcccaggat
aaatttcaagatgtgacacttttccagtcctacatgcaatacctgtccttaaaatacaaa
gctacagctgagcctctccaggccactgtgtcctcatgtgggcagctggccttgacaggg
cttttctcatcatgctttgagttcaatagtgatgacctggcagaggcaggagttgatgaa
gatgaaaagcttaccaccctcttgatgagcaaattcaccgcccagagactgagaccagtc
taccggtttttaggtcctctgttccaggagtttcttgctgccgtgaggttgactgaactc
ctgagttcagataggcaggaagaccaagatcttggactttattatttgagacaaatcgac
tcacctctgaaggcaataaactcctttaacatatttttgtattatgtctccagccactct
tcctcaaaggcagcgccaacagttgtatctcatttgcttcagttggtggatgagaaagag
tcactggagaacatgtctgaaaatgaggattacatgaagctccatccacaaacttttcta
tggtttcagtttgttagagggttgtggctggtgtctcctgaatcttcctcttcattcgtt
tcagaacatttattgcgccttgctctaatctttgcttatgaaagcaacacagttgctgaa
tgctctccatttattttgcaattccttcgaggaaaaacactggctttaagagtactgaat
ttacagtactttagggaccacccagaaagcctgttactgttgaggagcttaaaggtttcc
ataaatggaaataaaatgtcatcttatgtagattattcattcaagacatattttgaaaac
ttacagccaccagctatagatgaggagtatacatctgcctttgagcatataagtgaatgg
aggagaaattttgctcaagatgaggagatcataaaaaactatgaaaatatccgacccaga
gccctaccagacatcagtgaagggtactggaaactgtcccccaagccatgcaagatcccc
aagctggaagttcaagtgaacaacacggatgcagcagatcaagcactgctccaggtcctc
atggaagtcttctcagcttcacagagtattgagttccgtttattcaacagcagtggcttc
cttgaaagcatctgcccagctctggagctgagtaaggcctctgtcaccaagtgttccatg
tccaggctggagctcagcagagcagaacaggagctgcttctcaccctgcctgccctgcag
tctctcgaggtctcagagacaaaccagttaccagaacagctcttccataacttgcacaag
ttcctgggcctgaaagaactgtgtgtgagactagatggcaaaccgaatgtgctctcagtc
cttcctagagagttcccaaacctccttcacatggagaagttatccatccaaacctccacg
gagtctgacctctccaaactagttaaattcatccagaactttccaaatctccatgttttc
catctgaaatgtgatttcctttcaaattgtgagtctctcatggctgtgcttgcttcctgc
aagaaactcagagagattgagttttctggacgatgctttgaagccatgacctttgtcaac
attttgccaaattttgtttctctgaagatactgaatcttaaagatcaacaatttccagat
aaggaaacgtcagaaaagtttgcccaggctctgggttctctcaggaacctggaggaactg
ctcgttcccactggggacgggattcaccaagtggccaaactgattgtccggcagtgtctg
cagcttccgtgcctccgagttctcacctttcacgacatcttggacgatgacagtgtgatt
gaaattgccagggcggcaaccagtggaggtttccagaaacttgagaacttagatatttcc
atgaatcacaagattaccgaggaaggatatagaaatttctttcaagccctggacaacttg
ccaaacctacaagagctgaacatctgcaggaatatcccaggacgcattcaagttcaggcc
accactgtcaaggctctgggtcaatgtgtgtcccgactgcccagcctcatcagactgcac
atgctcagttggctcctggatgaagaggacatgaaagtgattaatgatgtgaaggaaaga
catccccagtctaaacgcttgattatcttctggaaattgatagtcccattctctcctgtt
atcctggagtaa

DBGET integrated database retrieval system