KEGG   Mus musculus (house mouse): 17955
Entry
17955             CDS       T01002                                 
Symbol
Nap1l4, 2810410H14Rik, D7Wsu30e, Nap2
Name
(RefSeq) nucleosome assembly protein 1-like 4
  KO
K11282  nucleosome assembly protein 1-like 4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    17955 (Nap1l4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     17955 (Nap1l4)
SSDB
Motif
Pfam: NAP Muted Lzipper-MIP1
Other DBs
NCBI-GeneID: 17955
NCBI-ProteinID: NP_032698
MGI: 1316687
Ensembl: ENSMUSG00000059119
UniProt: Q78ZA7 A2RSB1
Position
7:complement(143067316..143103698)
AA seq 375 aa
MAENSLSDGGPADSVEAAKNASNTEKLTDQVMQNPQVLAALQERLDNVSHTPSSYIETLP
KAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAE
SAWHSENEEEDKLAGDMKNKVVIAEKEAATVEELNPKGIPEFWFTIFRNVDMLSELVQEY
DEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNPVLTKTYKMKSEPDKADPFSFE
GPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFSPLKASG
DGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGD
EEGEDEDDADVNPKV
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggcagaaaacagtctttcagatggaggccctgcagattctgtggaagctgctaaaaat
gccagtaatacagaaaaactcacagaccaggtgatgcagaacccacaagtgctggcagct
ttgcaggaacgtcttgacaacgtctctcacactccttctagttacatagaaactttacct
aaagctgtcaaaagaagaattaatgccctgaagcagctccaggtgaggtgtgcgcacata
gaagctaagttctacgaggaagttcatgacctggagaggaagtatgcagccttgtaccag
cctctatttgacaagagaagagaattcatcactggtgacgtggagcccacagatgcagag
tcagcgtggcacagtgagaatgaggaggaggacaagttggctggagatatgaagaataaa
gtagtcatagctgagaaagaagcagcaacagtggaagagctgaaccccaaaggcatccct
gagttctggttcaccatcttcagaaatgtggacatgcttagtgagctggtgcaggaatat
gatgaaccgatcttgaaacatctgcaggatattaaagtgaagttttcagaccctggacaa
cctatgtcttttgtgctagagtttcactttgaacccaacgactacttcaccaatcctgtc
ctgacgaaaacgtacaagatgaaatcagagccagacaaggccgacccgttttcttttgaa
ggtcctgaaattgtggactgtgatgggtgtacaatagactggaagaaaggaaaaaatgtc
acagtcaaaaccatcaagaaaaagcagaagcacaagggccggggcaccgtacgaaccatc
accaagcaagtgcccaatgagtccttcttcaacttcttcagccccctgaaagcctctgga
gatggagaatctctggatgaagattccgagttcaccttagcctctgactttgaaattggg
cacttttttcgtgagcgcatcgtgccacgggctgtcctctacttcactggggaggccata
gaggatgatgacaattttgaagaaggcgaggaaggtgaagaggaggaattggaaggtgat
gaagaaggagaagatgaggatgatgctgatgttaaccccaaggtgtaa

DBGET integrated database retrieval system