KEGG   Mus musculus (mouse): 17966
Entry
17966             CDS       T01002                                 

Gene name
Nbr1, mKIAA0049
Definition
(RefSeq) NBR1, autophagy cargo receptor
  KO
K17987  next to BRCA1 gene 1 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    17966 (Nbr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17966 (Nbr1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17966 (Nbr1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    17966 (Nbr1)
  Pexophagy
   Other pexophagy associated proteins
    17966 (Nbr1)
  Aggrephagy
   Cargo receptors
    17966 (Nbr1)
  Xenophagy
    17966 (Nbr1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    17966 (Nbr1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    17966 (Nbr1)
SSDB
Motif
Pfam: N_BRCA1_IG PB1 ZZ C1_2
Other DBs
NCBI-GeneID: 17966
NCBI-ProteinID: NP_001239149
MGI: 108498
Ensembl: ENSMUSG00000017119
Vega: OTTMUSG00000002872
UniProt: P97432 Q05BC8 A1L329
Position
11 D; 11 65.36 cM
AA seq 988 aa
MEPQVTLNVTFKNETQSFLVSDPENTTWADVEAMVKVSFDLNTIQIKYLDEENEEISINS
QGEYEEALKMANIKQGNQLQMQVHEGYHVVDEALPKNVVENQAAARTGKKPLAHYSSLVR
VLGSDMKTTEEPAPEQCSSAPCDTDQPQDKPPDWFTSYLEMFREQVVKETVEKLEQRLQE
KLVLQKPLLSSSPTEVSMPISEETLFLPENQFSWHIACSHCQKRIVGVRYQCSLCPSYNI
CEDCEAGPYTHDTNHVLLKLRRPVVISSEPFFYSKYSAPRLPAALEQVRLQKQVDKNFVK
AEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLML
PLQPCAPVMPTLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWNTDTKLKFMWGNL
TLASTEKKDVLVPCLKAGHVGVVSVEFIAPTLEGTYTSHWRLSHKGQQFGPRVWCSIIVD
PFPSSESPDNVEGDRISSSKADDFSCEQEEAFLLAEEEIPLGEVTKQTEGTGASASQKTR
RAASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLPHDSPLI
EKPGLGQIQEESEGAGFKAPPDSTVSAKRKAETPASVEETEEDLSGTQFVCETVIRSLTL
DAAPDHNPPCRQRSPQRELQLYSTEGQQPLVLPGFCRKDSSLKFALPEEGPRGDEREEIV
HIVEEEVVEEEEEVQDEEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLER
GAEGEPGIESGLEPTEARERLPERESQPQEQSISDILTTSQPLDTVPLVPEVAGLPAALS
RSAPCGQCESSGVDSPGVDSPATMHEVPPAPDDIRGEPRGSTGLANSRQRSCDHSRHHNG
SSIAGGLVKGALSVAASAYKALFSGPPVTAQPIVSEDQTTALMAHLFEMGFCDRQLNLRL
LRKHNYNILQVVTELLQVNNNDWYSHRY
NT seq 2967 nt   +upstreamnt  +downstreamnt
atggaaccacaggttactctaaatgtgacttttaaaaatgaaactcaaagctttctggtt
tcggatccagaaaatacaacctgggctgatgttgaagctatggtaaaagtttcatttgat
ctgaatactatccagataaaatacctggatgaggagaacgaggagatatccatcaatagt
caaggtgaatatgaagaagcacttaagatggctaacattaagcaaggaaatcagctacag
atgcaagtccacgaagggtaccatgttgtagatgaagcactccccaaaaatgtggtagaa
aaccaagcggctgccaggacagggaagaagccacttgcacattattcttcactggtgaga
gtcttgggatcagacatgaagaccacagaggagcctgcaccagagcaatgttcttctgct
ccttgtgacacagaccagcctcaagacaagcccccagattggtttacaagctacctggag
atgttccgagaacaagtggttaaggaaacggtggagaaacttgaacagaggttgcaggag
aagcttgtcctccagaagccactcctgagttcctcacccacagaagtctcaatgcctatt
tcagaggaaaccctgtttttgccagagaaccagttcagctggcatattgcttgtagccac
tgccagaagaggatcgttggagtgcgctaccagtgtagcctatgcccatcctacaacatt
tgtgaagattgtgaagctggaccatacacccatgacactaaccatgttttgttaaagctg
cggagacctgttgtgatatcctctgagccatttttctactccaagtattccgctcctcgt
ctgcctgctgctttggaacaagtcaggctccaaaaacaggtggacaagaactttgtgaaa
gcagaaaagcaaaggttgcgggctgagaagaaacagcggaaggcagaggtcaaagagctt
aaaaagcagcttaaactccacaggaagattcatttatggaattcaatccatggacttcag
agtcccaagtcccctttgggccgacctgagagcttgctgcagtctaacaccctgatgctt
cctttgcagccctgtgccccagttatgccaacactcagtgcagcatttgtggatgagaat
ttgcctgatgggactcatcttcagccaggaaccaagtttattaaacactggaggatgaaa
aacacggggaatgtgaagtggaacacagacacaaagctcaagttcatgtggggaaacttg
actctggcttctacagagaagaaagatgttttggttccctgcttgaaggctggccacgtt
ggggtcgtgtctgtggagttcatcgctccaaccttggaggggacatacacttcgcactgg
cgtctctctcacaaaggccagcagtttgggcctcgggtttggtgcagtatcatagtggat
ccttttccttcctctgagagccctgataatgttgaaggggacaggatcagctcaagcaaa
gctgacgatttctcctgtgagcaagaggaagcttttcttctagctgaagaagagattcca
ttgggtgaggtgacaaagcagacagaagggacaggagccagtgcctcacagaagacaaga
cgcgctgccagtgaaagggagctgtacattccatctgtggacctcctgactgcccaggac
ctgctgtcctttgagctgctggatataaacattgtccaagaattggagagagtgccacac
aacacccctgtggatatgactccctgcatgtctcctctgccacatgacagtcctttaata
gagaagccaggcttggggcagatacaggaagagagtgaaggggcgggatttaaagcacct
cctgattccactgtatcagcaaagaggaaagctgagacccctgcttcggtcgaagaaaca
gaagaagacctgagtgggacccaatttgtatgtgagactgtaattcgatcccttaccttg
gatgctgctccagaccacaaccctccttgcaggcagaggtccccacagagggaattacag
ctgtattccaccgagggacagcagccacttgtgctgcctggattctgcagaaaggattct
tccttgaaatttgccttgcctgaagaaggaccgcgtggagatgagagggaggagattgtc
cacattgttgaggaagaagtcgttgaggaagaggaggaagtccaagatgaagaagtccaa
agtcagtcttctgcttcctctgaagattatatcatcatccttcctgagtgctttgatacc
agccgccccctgggggactccatgtacagctctgcgctctcccagccaggcctggagcga
ggggctgaaggcgaacctgggatcgagtctgggctggaaccaactgaggctagagagaga
ctcccagagagggagagccagccacaggagcagagcatcagcgacatcctcacaacctca
cagcctctggacacggtgcctctagtccccgaggtggcaggacttccagcagcattgtcc
aggagcgccccttgtggacagtgtgagtcatcaggagtggattcaccaggagtggattca
ccagctaccatgcacgaagttcccccagcccctgatgacatcagaggagagcccagaggc
tcaacaggactcgcaaacagcagacagaggagctgtgaccactcaaggcaccacaatggg
agcagcattgctggaggactggtgaagggggctttgtctgttgctgcctctgcgtacaag
gccctgttttctgggccaccagtcactgcacagcccatcgtttctgaagatcagaccaca
gccctgatggcccatctctttgaaatgggattctgcgacaggcagctgaacctaaggctg
ctgagaaaacacaattacaatatcctgcaggttgtgacagagctccttcaagtgaataac
aacgactggtacagccaccgctattga

DBGET integrated database retrieval system