KEGG   Mus musculus (mouse): 17967Help
Entry
17967             CDS       T01002                                 

Gene name
Ncam1, CD56, E-NCAM, NCAM-1, Ncam
Definition
(RefSeq) neural cell adhesion molecule 1
  KO
K06491  neural cell adhesion molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    17967 (Ncam1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05020 Prion diseases
    17967 (Ncam1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17967 (Ncam1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    17967 (Ncam1)
   04090 CD molecules [BR:mmu04090]
    17967 (Ncam1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    17967 (Ncam1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    17967 (Ncam1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    17967 (Ncam1)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  NCAM1/2
   17967 (Ncam1)
CD molecules [BR:mmu04090]
 Proteins
  17967 (Ncam1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface
   17967 (Ncam1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  17967 (Ncam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_5 Izumo-Ig Ig_4 Ig_C17orf99 Ig_6 C1-set Adeno_E3_CR1 Collagen_bind_2
Motif
Other DBs
NCBI-GeneID: 17967
NCBI-ProteinID: NP_001106675
MGI: 97281
Ensembl: ENSMUSG00000039542
Vega: OTTMUSG00000052150
UniProt: P13595
Structure
PDB: 

Position
9 A5.3; 9 26.83 cM
AA seq 1115 aa AA seqDB search
MLRTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMF
KNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGF
PEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDAS
IHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHM
VVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEG
NQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNC
TAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKS
LGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAALNGKGLGEISAATEFKTQPVR
EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRALASEWKPEIRLPSGSDHVM
LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTAGLSTGAIVGILIV
IFVLLLVVMDITCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVE
VRTEEERTPNHDGGKHTEPNETTPLTEPELPADTTATVEDMLPSVTTVTTNSDTITETFA
TAQNSPTSETTTLTSSIAPPATTVPDSNSVPAGQATPSKGVTASSSSPASAPKVAPLVDL
SDTPTSAPSASNLSSTVLANQGAVLSPSTPASAGETSKAPPASKASPAPTPTPAGAASPL
AAVAAPATDAPQAKQEAPSTKGPDPEPTQPGTVKNPPEAATAPASPKSKAATTNPSQGED
LKMDEGNFKTPDIDLAKDVFAALGSPAPATGASGQASELAPSTADSAVPPAPAKTEKGPV
ETKSEPPESEAKPAPTEVKTVPNDATQTKENESKA
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaactaaggatctcatctggactttgtttttcctgggaactgcagtttccctg
caggtagatattgttcccagccaaggagaaatcagcgttggagagtccaaattcttcctg
tgtcaagtggcaggagatgccaaagataaggacatctcctggttctcccccaatggggag
aagctgagcccaaaccagcagcggatctcagtggtgtggaatgatgacgactcctctacc
ctcaccatctacaacgccaacatcgacgatgccggcatatacaagtgtgtggtcacggct
gaggacggcacccagtctgaggccactgtcaacgtgaagatcttccagaagctcatgttc
aagaatgcaccaaccccacaggagtttaaggaaggggaggatgctgtgattgtctgtgat
gtggtcagctccctgcctccaaccatcatctggaaacacaaaggccgagatgtcattctg
aaaaaagacgtccggttcatagtcctgtccaacaactacctgcagatcaggggcatcaag
aaaacagatgagggtacttaccgctgtgagggcaggatcctggcccgcggggaaatcaac
ttcaaggacattcaggtcattgtgaatgtaccacccactgtccaggccagacagagcatc
gtgaatgccactgccaacctgggccagtctgtcaccctggtgtgtgatgccgatggcttc
ccagagcccaccatgagctggacaaaggatggggaacccatagagaacgaggaggaagat
gacgagaagcacatcttcagtgatgacagctccgagctgaccatcaggaatgtggataaa
aacgacgaggccgaatacgtctgcatcgcagagaacaaggctggcgagcaggatgcctcc
atccacctcaaggtctttgcaaagcccaaaatcacctatgtagagaatcagacggccatg
gaactagaggagcaagtcactctgacctgtgaagcctccggagaccccatcccctccatc
acctggagaacatccacccggaacatcagcagtgaagaaaagactctggatgggcacatg
gtggttcgcagccatgctcgtgtgtcctccttgaccctgaagagcatccagtacacagat
gctggagaatacatctgcactgccagcaacaccatcggccaggattcccagtccatgtac
ctcgaagttcaatatgctcccaagctccagggccctgtggctgtgtacacttgggaaggg
aaccaggtgaacatcacctgtgaggtcttcgcctacccaagtgccacaatctcctggttc
cgagatggtcagttgctgccaagctccaactacagcaatatcaagatctacaacacccca
tctgctagctatctggaggtgacccctgattcagaaaatgactttggaaactacaactgt
acagcagtgaaccgtattggacaggagtccttggaattcatccttgttcaagcagacaca
ccgtcttctccatccattgaccgggtggaaccatactccagcacagcgcaggtgcagttt
gatgagccagaggccacagggggcgtgcccattctcaagtacaaggctgagtggaagtcg
ctgggcgaagaatcctggcatttcaagtggtatgatgccaaagaagccaacatggaaggc
attgtcaccatcatgggcctgaaacctgagacgaggtactcggtacgactggcggccctc
aacggcaaggggctgggcgagatcagtgcagccactgagttcaagacacagccagtccgg
gaacccagtgcacccaagctggaagggcagatgggagaggacgggaactccatcaaggtg
aacctgatcaagcaggatgacggaggctcccccatcagacactatctggtcaagtacaga
gcgctcgcctctgagtggaaaccggaaatcaggctcccatccggcagtgaccacgtcatg
ctcaagtccctggactggaacgcagagtatgaagtctatgtggtagctgaaaaccagcaa
ggaaaatccaaggcagctcactttgtgttcaggacctcagcccagcccacggccatccca
gccaatggcagccccaccgcaggcctgagcacaggcgccattgtgggcatcctcattgtc
atcttcgtcctgctcctggtggtcatggacatcacctgctacttcctgaacaagtgtggc
ctgctcatgtgcatcgctgttaacctgtgtggcaaagctgggcccggagccaagggcaaa
gacatggaggagggcaaggctgctttctcgaaagatgagtcaaaagaacccattgtggag
gtccgaacggaggaagaacggactccaaaccatgatggggggaagcacacagagcccaac
gagaccacgccgctgacagaacccgagctgcctgccgacaccacagccactgtcgaggac
atgctgccttctgtcaccaccgtcaccactaactctgacactatcaccgaaacctttgcc
actgctcagaacagccctaccagtgagaccactacactgacctccagtattgccccaccg
gccacaactgtgccagactcaaattctgtgcccgctggtcaggccaccccttccaagggt
gtcactgcttcatcctcgtccccagcctcagcccccaaagttgctcctctggttgacctg
agtgatactccaacttcagctccctctgctagcaatctgtcctccactgtcttggctaac
caaggagctgtactcagtcctagcacccctgccagtgcgggagagacctccaaggcccct
ccagccagtaaggcctcccctgctcccacccccactccagctggggcagccagcccctta
gcagcagtagccgcccctgccacagatgccccccaggccaagcaggaagcccccagcacc
aaaggtccggacccagagcccacccagcctggcaccgtgaagaacccacctgaggcagcc
acagcccctgctagcccgaagagcaaggctgcaaccacaaacccttcccagggcgaggac
ttaaaaatggacgaagggaacttcaagaccccagatattgaccttgcaaaggatgttttt
gcagccctgggctctcctgctcccgccactggggccagtggacaagcctctgagcttgct
ccttccactgcagacagcgctgtgcctcccgcaccagcaaagaccgaaaagggccctgta
gaaacaaagtctgagcccccggagtcagaagccaagccagcgccaactgaagtcaagacg
gtccccaacgatgccacacaaacaaaagagaatgagagcaaagcatga

DBGET integrated database retrieval system