KEGG   Mus musculus (mouse): 17968
Entry
17968             CDS       T01002                                 

Symbol
Ncam2, Ncam-2, Ocam, RNCAM
Name
(RefSeq) neural cell adhesion molecule 2
  KO
K06491  neural cell adhesion molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu05020  Prion disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    17968 (Ncam2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    17968 (Ncam2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17968 (Ncam2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    17968 (Ncam2)
   04090 CD molecules [BR:mmu04090]
    17968 (Ncam2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    17968 (Ncam2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    17968 (Ncam2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    17968 (Ncam2)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  NCAM1/2
   17968 (Ncam2)
CD molecules [BR:mmu04090]
 Proteins
  17968 (Ncam2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   17968 (Ncam2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  17968 (Ncam2)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set C2-set_2 Ig_C17orf99 Ig_5 Ig_4 Izumo-Ig Adeno_E3_CR1 Pur_ac_phosph_N Herpes_gE
Other DBs
NCBI-GeneID: 17968
NCBI-ProteinID: NP_001106679
MGI: 97282
Ensembl: ENSMUSG00000022762
Vega: OTTMUSG00000014960
UniProt: O35136 Q71VC5
Position
16 C3.3; 16 45.89 cM
AA seq 837 aa
MSLLLSFYLLGLLVRSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEK
IISTQRVMLQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV
VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTIPDNRFAVLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTCKASGSPDP
TISWFRNGKLIEENEKYILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQVFV
QPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKRAIDGVMFSEGDKSPDGRIEVKGQH
GRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAPKFVSNQTMYYSWEGNPINI
SCDVTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKMILEIAPTSDNDFGRYNCTATNR
IGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFNKPESHGGVPIHHYQVDVKEVASE
TWKIVRSHGVQTMVVLSSLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIH
GQPSSGKSFKISITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAIIGLGVAALLLILVVTD
VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERIT
NHEDGSPVNEPNETTPLTEPEKLPLKEENGKEVLNAETIEIKVSNDIIQSKEDDIKA
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgagcctcctcctctccttctacctgctcgggttgcttgtcaggagcgggcaagctctt
cttcaagtgacaatttcacttagcaaagtagagcttagtgtgggtgagtctaaattcttc
acatgtacagccattggtgagcctgagagtatcgactggtataaccctcaaggagagaag
atcatttcaacgcagagggttatgctacagaaggagggtgtcaggtcacgactcaccatc
tacaatgcaaacatagaagatgcagggatatatcgctgtcaagcgacagatgccaaagga
cagacacaagaagctacagtagttttggaaatttaccaaaaactcaccttcagagaagtg
gtgtcccctcaagagttcaagcaaggggaggatgcagaagtggtttgcagagtgagcagt
tccccagcccctgcggtcagctggttgtaccacaatgaggaagtcaccaccatccccgac
aatcggtttgcagtgcttgcaaacaataatttgcagatcctcaatatcaataaaagtgat
gaaggtatatacagatgtgaaggaagagtggaggcgaggggagagattgacttccgggat
atcattgttattgttaacgttccaccagcaatcatgatgccccagaagtccttcaatgct
acagcagagagaggagaagagatgaccttaacatgcaaggcctcgggctccccagatcca
accatctcttggttcaggaacggcaaactcattgaagaaaatgaaaagtatattttaaag
ggcagtaatacagagctcactgtcaggaacataatcaataaagacgggggctcttatgtc
tgcaaagcaacaaacaaggcaggagaagatcaaaagcaggccttccttcaagtctttgta
cagcctcatatattacaacttaaaaatgagacaacatctgagaatggtcatgtcacactc
gtatgtgaagcagaaggggagcctgttccagaaatcacatggaaaagagccatagatgga
gtcatgttttctgaaggtgataagagtccggatggccgcatcgaagttaaagggcagcat
ggacgctcttcactgcacattagagatgtgaagttgtcagattcggggagatatgactgt
gaggccgctagtcggattggtgggcaccagaggagcatgcacctggacatcgaatatgct
cctaagtttgtttcaaatcagacaatgtattactcttgggaaggaaatccaatcaacata
agttgtgatgtgacagcaaacccacctgcgtcaatccactggagaagagagaaactgctc
ttaccagctaagaatacgactcatttaaaaactcacagtgtaggaagaaagatgatactc
gagattgcccccacatcagacaatgactttggacgatataactgcacagctactaaccgt
ataggcacaagatttcaggaatatattcttgaattagcagatgtcccctctagtccccat
ggagtgaagattatagagctgtcacagaccacagccaagatctctttcaataaacccgaa
tcccatggaggtgtgcctattcatcactatcaagtggatgtcaaagaagtggcatcagaa
acctggaaaatagtacgctcccatggagttcaaacgatggttgttttgagcagtctggaa
ccaaatacgacttacgaaattagggttgcagcagtgaatggcaaaggtcaaggagactac
agtaaaatagaaatattccagacactgccagtccgtgagccaagtcccccttccatacat
ggacagccaagcagtggcaagagttttaaaatcagcatcaccaagcaagatgatggaggg
gctcctattttagaatacattgtaaaatacagaagtaaagacaaggaagatcagtggcta
gagaagaaggtacagggaaataaagaccacattatcttggagcatctgcagtggacaatg
ggctacgaagtgcaaatcacagctgccaacagactgggatattctgagcctactgtatat
gagttcagcatgcccccaaaacccaacattattaaagacacactttttaatggccttggc
ctaggagccatcattggccttggagttgctgcccttttgctaatccttgtggtaacagac
gtcagctgcttcttcattcgacaatgtgggttactaatgtgcatcaccaggagaatgtgc
gggaaaaagagtggctccagtgggaaaagtaaagaacttgaagaaggaaaagcagcttac
ctgaaagatggatcaaaagaaccgatagtggaaatgagaacagaagatgaaagaatcact
aaccatgaagatgggagtccagtaaatgagccaaatgaaaccacaccgctaacagaacct
gaaaaattgcctttaaaagaagaaaacggaaaggaagttttaaacgcagaaactatagaa
attaaagtgtccaatgacatcatccagtctaaagaagatgacataaaggcatga

DBGET integrated database retrieval system