KEGG   Mus musculus (mouse): 17969
Entry
17969             CDS       T01002                                 

Gene name
Ncf1, NCF-47K, NO, NOXO2, Ncf-, Ncf-1, p47-phox, p47<ph, p47<phox>, p47p, p47phox
Definition
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu05020  Prion disease
mmu05140  Leishmaniasis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17969 (Ncf1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    17969 (Ncf1)
   04666 Fc gamma R-mediated phagocytosis
    17969 (Ncf1)
   04670 Leukocyte transendothelial migration
    17969 (Ncf1)
   04062 Chemokine signaling pathway
    17969 (Ncf1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    17969 (Ncf1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    17969 (Ncf1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    17969 (Ncf1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    17969 (Ncf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17969 (Ncf1)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    17969 (Ncf1)
SSDB
Motif
Pfam: SH3_1 NECFESHC SH3_9 p47_phox_C PX SH3_2 SH3_3 hSH3 SH3_6
Other DBs
NCBI-GeneID: 17969
NCBI-ProteinID: NP_035006
MGI: 97283
Ensembl: ENSMUSG00000015950
Vega: OTTMUSG00000020372
UniProt: Q09014 Q3UBI5
Position
5 G2; 5 74.47 cM
AA seq 390 aa
MGDTFIRHIALLGFEKRFIPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPI
EAGEIHTENRVIPHLPAPRWFDGQRAAESRQGTLTEYFNGLMGLPVKISRCPHLLDFFKV
RPDDLKLPTDSQAKKPETYLVPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATG
DVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAV
EEDEMSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAP
PRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPGRPGPLSTDGTKDNPSTPRVK
PQPAVPPRPSSDLILHRCTESTKRKLTSAV
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgggggacaccttcattcgccatattgccctgctgggcttcgagaagcgcttcatcccc
agccagcactatgtgtacatgttcctggttaagtggcaggacctgtcggagaaggtggtc
tacagaaaattcaccgagatctacgagttccataaaatgctgaaggagatgttccccatt
gaggccggcgagatccacacagagaacagagtcatcccacacctcccggcacccaggtgg
tttgatgggcaacgagccgctgagagtcgccagggcactctcactgaatacttcaacggc
ctcatgggactgcccgtgaagatctcccgctgcccacacctgctggacttcttcaaagtg
cggcctgatgacctgaaactgcccactgacagccaggcgaagaagcctgagacatacctg
gtgcccaaagatggcaagaataacgtagctgacatcacaggccccatcatccttcagacc
tatcgggccattgctgactacgagaagagttcgggaacagagatgaccgtggcaaccgga
gacgtggtggacgttgtggagaagagcgagagcggctggtggttttgccagatgaagaca
aagcgaggttgggtccctgcatcctatctggagccccttgacagtcccgacgaggcggag
gatccggatcccaactacgcaggtgaaccgtatgtaaccatcaaagcgtacgctgctgtt
gaagaggacgagatgtccctgtctgagggtgaagccattgaggtcattcataagctcctg
gatggctggtgggtggtcaggaaaggggatatcaccggctatttcccatccatgtatctg
cagaaggctggggaggagataacccaggcccagcgacagatcagaggccgcggggcacca
cctcgaaggtcgaccatccgcaacgcacagagcatccaccagcgttctcggaagcgcctt
agccaggacacctatcgccgcaacagcgtccgattcctgcagcagcgcagacgcccgggg
cgacccgggccgctgagcacggatggcacaaaggacaatccatcgactccgcgcgtcaaa
ccacagcccgcggtgcctccgcgacccagctcggacctcatcctgcaccgctgcacagag
agcaccaaacggaagctgacgtccgctgtgtga

DBGET integrated database retrieval system