KEGG   Mus musculus (mouse): 17970
Entry
17970             CDS       T01002                                 

Gene name
Ncf2, NO, NOXA2, Ncf-, Ncf-2, p67p, p67phox
Definition
(RefSeq) neutrophil cytosolic factor 2
  KO
K08010  neutrophil cytosolic factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04670  Leukocyte transendothelial migration
mmu05020  Prion disease
mmu05140  Leishmaniasis
mmu05415  Diabetic cardiomyopathy
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17970 (Ncf2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    17970 (Ncf2)
   04670 Leukocyte transendothelial migration
    17970 (Ncf2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    17970 (Ncf2)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    17970 (Ncf2)
  09164 Neurodegenerative disease
   05020 Prion disease
    17970 (Ncf2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    17970 (Ncf2)
   05415 Diabetic cardiomyopathy
    17970 (Ncf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17970 (Ncf2)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    17970 (Ncf2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 TPR_1 TPR_2 PB1 TPR_8 TPR_12 SusD-like_3 TPR_17 TPR_9 TPR_6 TPR_11
Other DBs
NCBI-GeneID: 17970
NCBI-ProteinID: NP_035007
MGI: 97284
Ensembl: ENSMUSG00000026480
Vega: OTTMUSG00000049696
UniProt: O70145
Position
1 G3; 1 65.05 cM
AA seq 525 aa
MSLAEAIRLWNEGVLAADKKDWKGALEAFSEVQDPHSRICFNIGCVNTILENLQAAEQAF
TKSINRDKHSAVAYFQRGMLYYRMEKYDLAIKDLKEALTQLRGNQLIDYKILGLQFKLFA
CEVLYNIALMHAKKEEWKKAEEQLALATNMKSEPRHSKIDKAMESIWKQKLFEPVVIPVG
RLFRPNERQVAQLAKKDYLGKATVVASVVHQDNFSGFAPLQPQSAEPPPRPKTPEIFRAL
EGEAHRVLFGFVPETPEELQVMPGNIVFVLKKGSDNWATVMFNGQKGLVPCNYLEPVELR
IHPQSQPQEDTSPESDIPPPPNSSPPGRLQLSPGHKQKEPKELKLSVPMPYMLKVHYKYT
VVMETRLGLPYSQLRNMVSKKLALSPEHTKLSYRRRDSHELLLLSEESMKDAWGQVKNYC
LTLWCEHTVGDQGLIDEPIQRENSDASKQTTEPQPKEGTQVVAIFSYEAAQPEDLEFVEG
DVILVLSHVNEEWLEGECKGKVGIFPKAFVEGCAAKNLEGIPREV
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtccctggctgaggccatcagactctggaatgaaggggtgctcgcagccgacaagaag
gactggaagggtgccctggaggccttcagcgaggtgcaggacccccactcgaggatttgc
ttcaacataggctgcgtgaacactatcctggaaaacttgcaggcagccgagcaggccttc
accaaaagcatcaacagagacaagcactctgcagtggcctacttccagagaggaatgctc
tactacagaatggagaagtacgaccttgctatcaaagaccttaaagaggccttgacgcag
cttcgtgggaaccagctgatagactacaagatcctggggctgcagttcaagctgtttgcc
tgtgaggtattgtacaatattgctctcatgcatgccaagaaagaggaatggaagaaagca
gaagagcagttggcattggcaaccaacatgaagtccgagcccaggcattccaagatcgac
aaggccatggagagcatctggaagcagaagctgttcgagcccgtggtgatccctgtgggt
cggctgttccgtccaaatgagaggcaggtggctcagctggccaaaaaggactatctgggc
aaggctacggttgtagcatctgtggttcaccaagacaacttttctggcttcgcccctctg
cagccacagtcagcagagcctcctcccagacccaaaaccccagaaatcttcagggctctg
gaaggtgaggcacaccgcgtattgtttggctttgtgccggagacgccagaagagctacag
gtcatgcctgggaacatcgtctttgtcttgaagaagggcagtgataactgggccacagtc
atgttcaatggacagaaggggcttgtcccctgcaactacctggagccagttgagcttcgg
attcaccctcagtcgcagccccaggaagatacctctccagaatccgatattccaccacct
cctaattctagccccccaggaagactccagttgtcaccaggtcacaagcaaaaagagccc
aaggaactgaagctcagcgtgcctatgccttacatgctcaaggtgcattacaaatacaca
gtggtcatggagacgcggcttggcctcccctacagccagcttcggaacatggtgtctaag
aagctggcgctctcgccagaacacactaaactgagctaccggcgtcgggacagccacgag
cttctgctcctgtccgaagaaagcatgaaggatgcctggggccaagtgaaaaactactgc
ctgactctgtggtgtgagcatacggtgggtgaccaaggtcttattgatgaacccatacaa
agggaaaactcagacgccagtaagcagactacggagcctcagcctaaggaggggacccag
gtggtagcaatcttcagttatgaggctgcccagccagaagacctggaatttgtggaagga
gatgtaatcctggtactgtcacatgtgaatgaagaatggctggaaggggagtgtaaaggg
aaagttggcattttcccgaaggcttttgttgaaggatgtgcagccaagaatttggaaggc
attcccagagaagtctag

DBGET integrated database retrieval system