KEGG   Mus musculus (mouse): 17972
Entry
17972             CDS       T01002                                 

Gene name
Ncf4, AI451400, p40p, p40phox
Definition
(RefSeq) neutrophil cytosolic factor 4
  KO
K08012  neutrophil cytosolic factor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04670  Leukocyte transendothelial migration
mmu05020  Prion disease
mmu05140  Leishmaniasis
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17972 (Ncf4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    17972 (Ncf4)
   04670 Leukocyte transendothelial migration
    17972 (Ncf4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    17972 (Ncf4)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    17972 (Ncf4)
  09164 Neurodegenerative disease
   05020 Prion disease
    17972 (Ncf4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17972 (Ncf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17972 (Ncf4)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    17972 (Ncf4)
SSDB
Motif
Pfam: PB1 PX SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 17972
NCBI-ProteinID: NP_032703
MGI: 109186
Ensembl: ENSMUSG00000071715
Vega: OTTMUSG00000028142
UniProt: P97369
Position
15 E1; 15 37.1 cM
AA seq 339 aa
MALAQQLRSESDFEQLPDDVAVSANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFYALQSKLEERFGPESKNSPFTCSLPTLPAKVYMGAKQEIAETRIPALNAYMKNLLSLP
VCVLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGVSPQGAIMDRMEAPRAEALFD
FTGNSKLELSFKAGDVIFLLSKINKDWLEGTSQGATGIFPGSFVKILKDFPEDEDTTNWL
RCYFYEDTGKTIKDIAVEEDLSSTPLFKDLLALMRREFQREDIALSYQDAEGDLVRLLSD
EDVGLMVKQARGLPSQKRLFPWKLHVTQKDNYSVYNTVP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggccctggcccagcagctgcgatcagagagcgactttgagcagcttccagacgatgtg
gccgtctcagccaacatcgctgacatcgaggagaagaggggcttcaccagccactttgtt
tttgtcatcgaggtcaaaacaaaaggagggtccaagtatctcatctaccgccgctatcgc
cagttctacgccctgcagagcaagctggaggagcggtttgggccagagagcaagaacagc
cctttcacctgcagcctgcccacattgccagccaaagtctacatgggcgcaaaacaagag
atcgctgagactcggatcccggccctcaatgcctacatgaagaacctcctgagcctgccg
gtctgcgtgctgatggaccccgacgtcaggatcttcttctatcagtctgcatacgatgct
gagcaggtgccccaggcactccgcaggctccgaccgcgcacgcgcaaaatcaagggtgtg
tctccacaaggggccatcatggatcgcatggaagcgccaagagcagaggccttgtttgac
ttcactgggaacagcaaattggagctaagtttcaaagctggagatgtgatcttccttctc
agtaagatcaacaaagactggctggagggcacctcccagggagccacaggcatcttccca
gggtccttcgtgaagatccttaaggactttcccgaggacgaggacaccaccaactggcta
cgatgctacttctatgaagacacaggcaaaaccatcaaggacattgcggtggaggaggac
ctcagcagcacgcccctgttcaaagacctgctagcgctcatgaggcgtgagttccagaga
gaagacattgcccttagctaccaggatgctgagggggacttggttaggctgctgtcagat
gaggatgtgggactcatggtgaagcaagcccgaggcctcccttcccagaagcgcctcttc
ccctggaagctgcatgtcacacagaaggacaactacagtgtctacaacactgtcccctga

DBGET integrated database retrieval system