KEGG   Mus musculus (mouse): 17973
Entry
17973             CDS       T01002                                 

Gene name
Nck1, 6330586M15Rik, D230010O13Rik, Nc, Nck, Nck-1
Definition
(RefSeq) non-catalytic region of tyrosine kinase adaptor protein 1
  KO
K07365  NCK adaptor protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04360  Axon guidance
mmu04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    17973 (Nck1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    17973 (Nck1)
  09158 Development and regeneration
   04360 Axon guidance
    17973 (Nck1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    17973 (Nck1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   17973 (Nck1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 17973
NCBI-ProteinID: NP_035008
MGI: 109601
Ensembl: ENSMUSG00000032475
Vega: OTTMUSG00000021049
UniProt: Q99M51 Q8BH99
Position
9; 9 E3.3
AA seq 377 aa
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggctgaagaagtggtggtggtggccaaatttgattatgtggcacagcaggaacaagag
ctggatatcaagaagaatgagcgattatggctcctggatgactctaaatcctggtggcga
gttcgaaattccatgaataaaacaggttttgtcccttctaactatgtggaaagaaaaaac
agtgctcggaaagcatctattgttaaaaacctgaaggacaccttaggtattggaaaagtg
aaaagaaaacccagtgttccagatactgcatctcctgctgatgatagctttgttgatcca
ggagaacgtctctatgaccttaacatgcctgcttttgtgaaatttaactacatggctgag
agagaggatgagttgtcattgataaaagggaccaaggtgatcgtcatggagaaatgcagt
gatggatggtggcgtggcagctacaacggacaaattggatggtttccttcaaactatgta
actgaagaaggtgacagtcctttgggtgatcatgtaggttctctgtcagagaaattagca
gcagttgtcaataacctaaatacgggtcaagtattgcatgttgtacaggctctttacccg
tttagctcatccaatgatgaagaactcaattttgagaaaggcgatgtaatggatgttatt
gaaaagccggaaaatgacccagagtggtggaaatgcaggaaaatcaatggcatggttggc
ctggtgccaaaaaactacgttaccattatgcaaaacaatccattaacctcaggtttggaa
ccatctcctccacaatgtgattacattaggccttcactcactgggaagtttgctggcaat
ccttggtattatggcaaagtcaccaggcaccaggcagaaatggcattaaatgaaagaggg
catgaaggagacttcctcattcgtgacagtgaatcttcgccaaatgatttctcagtatca
ctaaaagcacaagggaaaaacaagcattttaaagtccagctgaaagagactgtttactgc
attgggcagcggaaattcagcaccatggaggaacttgtagaacattacaaaaaggcaccg
atctttacaagtgagcaaggagaaaaattatatctcgtcaagcatttgtcttga

KEGG   Mus musculus (mouse): 17974
Entry
17974             CDS       T01002                                 

Gene name
Nck2, 4833426I10Rik, Grb, Grb4, NCKbe, NCKbeta, Nck-2
Definition
(RefSeq) non-catalytic region of tyrosine kinase adaptor protein 2
  KO
K19862  NCK adaptor protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04360  Axon guidance
mmu04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    17974 (Nck2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    17974 (Nck2)
  09158 Development and regeneration
   04360 Axon guidance
    17974 (Nck2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    17974 (Nck2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   17974 (Nck2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 NolB SH2_2
Other DBs
NCBI-GeneID: 17974
NCBI-ProteinID: NP_035009
MGI: 1306821
Ensembl: ENSMUSG00000066877
Vega: OTTMUSG00000021065
UniProt: O55033 Q8BQ28
Position
1; 1 C1.1
AA seq 380 aa
MTEEVIVIAKWDYTAQQDQELDIRKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKPSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSFNGQIGWFPSNYVLEEADEAAAEAPSFL
SLRRGTALSNGQGARVLHVVQTLYPFSSVTEEELSFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHTPQISYTGPSASGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGRNKHFKVQLVDSVYCIGQRRFHSMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgacagaagaagtcattgtcatagccaagtgggactacactgcccagcaggaccaggag
ctcgacatcaggaagaacgagcggttgtggctgctagatgactccaagacgtggtggcgg
gtgaggaatgctgccaacaggacaggctacgtgccttccaactatgtggagcgtaagaac
agcctgaagaagggctccctggtgaagaacctcaaggacacactaggcctcggaaagacg
cgcaggaagccaagcgctcgggatgcttccccaacgccaagcactgatgcggagtaccca
gccaatggcagcggtgctgaccgcatctatgacctcaacatcccagcctttgtcaagttc
gcctacgtagcagaacgagaggatgagctgtccctggtgaagggctcccgtgtcacagtt
atggagaaatgcagtgatggctggtggcgtggcagcttcaacgggcagatcggctggttc
ccctccaactacgttttggaggaagcggacgaagctgcggctgaggcccccagcttcctg
agcctacgtcggggcactgcactgagcaatgggcagggtgcacgggtgctgcacgtggtg
cagacgctgtaccccttcagctcggtcactgaggaggagcttagtttcgagaagggggag
accatggaggtgattgagaagccggagaatgaccctgaatggtggaaatgcaaaaatgcc
cgaggccaagtgggcctggtccccaaaaactacgtggttgttctcagtgatgggcctgct
ctgcaccccgctcacaccccccagatcagctacaccgggccttcagccagcgggcgcttt
gctggtcgggagtggtactatggcaacgtgacacggcaccaggccgagtgtgcgctcaat
gagcggggcgtcgagggcgacttcctcattagggacagcgagtcctcgcccagtgacttc
tccgtgtctctcaaagcgtcagggagaaacaagcacttcaaggtgcagctggtggacagc
gtctactgcattgggcagcggcggttccacagcatggacgagcttgtggagcactacaag
aaggcccccatcttcaccagcgagcacggggagaagctctaccttgtccgagccctacag
tga

DBGET integrated database retrieval system