KEGG   Mus musculus (mouse): 17974Help
Entry
17974             CDS       T01002                                 

Gene name
Nck2, 4833426I10Rik, Grb4, NCKbeta, Nck-2
Definition
(RefSeq) non-catalytic region of tyrosine kinase adaptor protein 2
  KO
K19862  NCK adaptor protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04360  Axon guidance
mmu04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    17974 (Nck2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    17974 (Nck2)
  09158 Development
   04360 Axon guidance
    17974 (Nck2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2 NolB
Motif
Other DBs
NCBI-GeneID: 17974
NCBI-ProteinID: NP_035009
MGI: 1306821
Ensembl: ENSMUSG00000066877
Vega: OTTMUSG00000021065
UniProt: O55033 Q8BQ28
Position
1; 1 C1.1
AA seq 380 aa AA seqDB search
MTEEVIVIAKWDYTAQQDQELDIRKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKPSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSFNGQIGWFPSNYVLEEADEAAAEAPSFL
SLRRGTALSNGQGARVLHVVQTLYPFSSVTEEELSFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHTPQISYTGPSASGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGRNKHFKVQLVDSVYCIGQRRFHSMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaagtcattgtcatagccaagtgggactacactgcccagcaggaccaggag
ctcgacatcaggaagaacgagcggttgtggctgctagatgactccaagacgtggtggcgg
gtgaggaatgctgccaacaggacaggctacgtgccttccaactatgtggagcgtaagaac
agcctgaagaagggctccctggtgaagaacctcaaggacacactaggcctcggaaagacg
cgcaggaagccaagcgctcgggatgcttccccaacgccaagcactgatgcggagtaccca
gccaatggcagcggtgctgaccgcatctatgacctcaacatcccagcctttgtcaagttc
gcctacgtagcagaacgagaggatgagctgtccctggtgaagggctcccgtgtcacagtt
atggagaaatgcagtgatggctggtggcgtggcagcttcaacgggcagatcggctggttc
ccctccaactacgttttggaggaagcggacgaagctgcggctgaggcccccagcttcctg
agcctacgtcggggcactgcactgagcaatgggcagggtgcacgggtgctgcacgtggtg
cagacgctgtaccccttcagctcggtcactgaggaggagcttagtttcgagaagggggag
accatggaggtgattgagaagccggagaatgaccctgaatggtggaaatgcaaaaatgcc
cgaggccaagtgggcctggtccccaaaaactacgtggttgttctcagtgatgggcctgct
ctgcaccccgctcacaccccccagatcagctacaccgggccttcagccagcgggcgcttt
gctggtcgggagtggtactatggcaacgtgacacggcaccaggccgagtgtgcgctcaat
gagcggggcgtcgagggcgacttcctcattagggacagcgagtcctcgcccagtgacttc
tccgtgtctctcaaagcgtcagggagaaacaagcacttcaaggtgcagctggtggacagc
gtctactgcattgggcagcggcggttccacagcatggacgagcttgtggagcactacaag
aaggcccccatcttcaccagcgagcacggggagaagctctaccttgtccgagccctacag
tga

DBGET integrated database retrieval system