KEGG   Mus musculus (mouse): 17975
Entry
17975             CDS       T01002                                 

Gene name
Ncl, B530004O11Rik, C23, D0Nds28, D1Nds28, Nucl
Definition
(RefSeq) nucleolin
  KO
K11294  nucleolin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    17975 (Ncl)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17975 (Ncl)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    17975 (Ncl)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     17975 (Ncl)
SSDB
Motif
Pfam: RRM_1 Treacle
Other DBs
NCBI-GeneID: 17975
NCBI-ProteinID: NP_035010
MGI: 97286
Ensembl: ENSMUSG00000026234
Vega: OTTMUSG00000048094
UniProt: P09405
Position
1 C5; 1 43.94 cM
AA seq 707 aa
MVKLAKAGKTHGEAKKMAPPPKEVEEDSEDEEMSEDEDDSSGEEEVVIPQKKGKKATTTP
AKKVVVSQTKKAAVPTPAKKAAVTPGKKAVATPAKKNITPAKVIPTPGKKGAAQAKALVP
TPGKKGAATPAKGAKNGKNAKKEDSDEDEDEEDEDDSDEDEDDEEEDEFEPPIVKGVKPA
KAAPAAPASEDEEDDEDEDDEEDDDEEEEDDSEEEVMEITTAKGKKTPAKVVPMKAKSVA
EEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKRKKEMTKQKEAPEAKKQKV
EGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAE
DLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAME
IRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTS
TWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEA
LNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTD
RETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGF
GGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDFKPQGKKTKFE
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggtgaagctcgcaaaggctggcaaaacccacggtgaggccaagaaaatggctcctcct
ccaaaggaggtggaagaggatagtgaagatgaagaaatgtcagaagatgaagatgacagc
agtggagaagaggaggttgtcatccctcagaaaaaaggcaaaaaggctaccacaacccca
gcaaagaaggtggttgtttcacaaacaaaaaaggctgcagttcccacaccagctaagaaa
gcagctgtgaccccaggcaaaaaggcagtagccacaccagctaagaaaaacattacacca
gccaaagtcattccaacaccgggtaagaagggagctgcacaagcaaaagcgttggtacca
actcctggtaaaaagggagctgccactccagctaagggggctaagaacggtaagaatgcc
aagaaggaagacagtgatgaggatgaagatgaagaggatgaagatgatagcgatgaggat
gaagatgatgaggaagaggatgagtttgagccaccaatagtaaaaggagtgaagccagca
aaagcagctcctgctgctcctgcctcagaggatgaggaagatgatgaggatgaagatgat
gaggaagatgatgatgaagaggaggaagatgactctgaggaagaagttatggagatcaca
acagccaaaggaaagaaaactcctgcaaaagttgttcctatgaaagccaagagtgtggct
gaggaggaggatgatgaggaagaggatgaagatgacgaggatgaggatgatgaggaagag
gatgacgaagatgatgatgaggaagaagaggaggaagaacctgttaaagcagcacctgga
aaacggaagaaggagatgaccaagcagaaagaagcccctgaagccaagaaacagaaagta
gaaggctcagaaccaactacacctttcaatctgttcattggaaaccttaatccaaacaag
tctgttaatgaattaaaatttgccatcagtgaactttttgctaaaaatgatcttgctgtt
gtggatgtcagaactggtacaaataggaaatttggttatgtggactttgagtctgctgaa
gacctagaaaaggccttggagctcactggtttaaaagtgtttggcaatgaaattaaacta
gaaaaaccaaaaggaagagatagtaagaaagttcgagctgcaagaacacttctagccaaa
aacctctctttcaacatcactgaggatgaattaaaggaagtgtttgaagacgccatggag
atcagattagtcagccaggatgggaaaagtaaagggattgcttatattgaatttaagtct
gaagctgatgcagagaaaaatttggaagaaaagcagggggcagaaattgatggacgatct
gtttcactctactatactggagagaaaggtcaaaggcaagagagaactggaaagaccagc
acttggagtggtgaatcaaagactttggttttaagtaacctttcctacagtgcaacaaaa
gaaactcttgaggaagtatttgagaaagcaacttttatcaaagtgccccagaacccacat
ggcaaacctaaagggtatgcatttatagaatttgcttcatttgaagatgctaaagaagct
ttaaattcctgtaataaaatggaaattgagggcagaacaatcaggctggagttgcaagga
tccaattcgagaagtcaaccatccaaaactctgtttgtcaaaggtctgtctgaggatacc
actgaagagaccttaaaagaatcatttgagggctctgttcgtgcaagaatagtcactgat
cgggaaactggttcttccaaagggtttggttttgtagactttaatagtgaggaagatgcc
aaagctgccaaggaggccatggaagatggagaaattgacggaaacaaagttaccttggac
tgggccaaacctaagggtgaaggtggctttggtggtcgaggtggaggcagaggaggtttc
ggaggcagaggtggaggcagaggtggaagaggtggatttggaggaagaggccggggaggc
tttggaggtagaggaggcttccgaggcggcagaggaggagggggagacttcaagccacaa
ggaaagaagacgaagtttgaatag

DBGET integrated database retrieval system