KEGG   Mus musculus (mouse): 17978Help
Entry
17978             CDS       T01002                                 

Gene name
Ncoa2, D1Ertd433e, GRIP-1, Grip1, KAT13C, NCoA-2, SRC-2, TIF2, bHLHe75
Definition
(RefSeq) nuclear receptor coactivator 2
  KO
K11255  nuclear receptor coactivator 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
mmu04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    17978 (Ncoa2)
   04919 Thyroid hormone signaling pathway
    17978 (Ncoa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    17978 (Ncoa2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    17978 (Ncoa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NCOA_u2 PAS_11 DUF4927 DUF1518 Nuc_rec_co-act SRC-1 PAS_3 PAS PAS_9 HLH
Motif
Other DBs
NCBI-GeneID: 17978
NCBI-ProteinID: NP_032704
MGI: 1276533
Ensembl: ENSMUSG00000005886
Vega: OTTMUSG00000021630
UniProt: Q61026 Q8BN74 Q8CE59 Q8C961 Q8CAG7 Q8CBM5
Position
1 A3; 1 4.12 cM
AA seq 1462 aa AA seqDB search
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGSVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSM
VNGGSWSGEPPRRSSHTFNCRMLVKPLPDSEEEGHDSQEAHQKYEAMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPTLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHTQHEGESLSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQAMGKPLNPISSSSPAHQALCSGNPGQDMTLG
SNINFPMNGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPG
QASSVLSPRQRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
EASCHPEEQKGPNDSSMPQAASGDRAEGHSRLHDSKGQTKLLQLLTTKSDQMEPSPLPSS
LSDTNKDSTGSLPGPGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQESS
STAPGSEVTVKQEPASPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIAMKTVKEEVSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPTGSVDKQAII
NDLMQLTADSSPVPPAGAQKAALRMSQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG
PFPPIRNSSPYSVIPQPGMMGNQGMLGSQGNLGNNSTGMIGSSTSRPSMPSGEWAPQSPA
VRVTCAATTGAMNRPVQGGMIRNPTASIPMRANSQPGQRQMLQSQVMNIGPSELEMNMGG
PQYNQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALL
DQLYLALRNFDGLEEIDRALGIPELVSQSQAVDAEQFSSQESSIMLEQKPPVFPQQYASQ
AQMAQGGYNPMQDPNFHTMGQRPNYTTLRMQPRPGLRPTGIVQNQPNQLRLQLQHRLQAQ
QNRQPLMNQISSVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMQQQVQQRT
LMMRGQGLNVTPSMVAPAGLPAAMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQ
SPLMSPRMAHTQSPMMQQSQANPAYQPTSDMNGWAQGSMGGNSMFSQQSPPHFGQQANTS
MYSNNMNISVSMATNTGGLSSMNQMTGQMSMTSVTSVPTSGLPSMGPEQVNDPALRGGNL
FPNQLPGMDMIKQEGDASRKYC
NT seq 4389 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggatgggagaaaacacctctgacccgtccagggcagagaccagaaaacgcaag
gaatgtcccgaccagctcggacccagccccaaaaggagcactgagaaacggaaccgcgag
caggagaataagtacatagaggagctggccgagctgatcttcgcaaactttaatgatatt
gacaacttcaacttcaaacctgacaaatgtgccatcctaaaagaaactgtgaagcagatc
cgccagatcaaagagcaagagaaagcagcagctgccaacatagatgaagtgcagaagtca
gatgtgtcgtccacggggcagggtgtcatcgacaaggatgcactggggcccatgatgctt
gaggccctcgatgggttcttcttcgttgtgaacctggaaggcagtgtggtgttcgtgtca
gagaatgtgacacagtatctacggtataaccaagaagagctgatgaacaagagtgtctac
agcatcctgcatgtcggggaccacactgaatttgtcaagaacctgctgccaaagtccatg
gtgaatggaggatcctggtctggagaacctcccaggcggagcagccataccttcaactgt
cgcatgctggtgaagcctttgccagattcagaagaggaaggccatgatagccaggaagcc
catcagaaatacgaggcgatgcagtgcttcgctgtgtctcagcccaagtccatcaaagag
gaaggcgaagatttgcagtcctgcttgatttgtgtggcacgaagagtccccatgaaggaa
agaccaactcttccctcatcagaaagctttaccacccgccaggacctccaaggcaagatc
acttcactggacactagcaccatgagagccgccatgaagccgggctgggaagatctggta
agaagatgcattcagaagttccacacacagcatgaaggggagtctctatcatatgccaag
aggcatcaccatgaagttctgagacaagggttggcgttcagtcagatctatcgtttttct
ttgtctgatggcactctcgttgctgcacaaaccaagagcaaactcatccgttctcagact
actaatgagcctcagcttgtaatatctttacacatgcttcacagagagcagaatgtatgt
gtaatgaatccggatctgactggacaagcgatggggaagccattgaatccaattagctct
agcagccctgcccaccaggccctgtgcagtgggaacccaggtcaggacatgaccctcggt
agcaatataaattttcccatgaatggcccaaaggaacaaatgggcatgcctatgggcagg
tttggtggttctgggggcatgaaccatgtgtcaggcatgcaagcaaccactcctcagggt
agtaactatgcactcaaaatgaacagtccctcgcaaagcagccccggcatgaacccgggg
caagccagctccgtgctctccccaaggcagcgcatgagccccggcgtggctggcagtcct
cgcatcccacccagtcagttttcccctgcaggaagcttgcattcccctgtgggagtttgc
agcagcacaggaaatagccatagttataccaacagttccctcaatgcactgcaagccctc
agcgagggccatggggtctcactcgggtcctcgctggcttcaccggacctaaaaatgggc
aatttgcaaaactccccagttaatatgaatcctcccccactcagcaagatgggaagcttg
gactccaaagactgttttggactttatggggagccctcagaaggtacaactggacaagca
gaggccagctgccatcctgaagaacaaaaggggcccaatgattccagcatgccccaggcg
gccagcggggacagggctgagggacacagccggctgcatgacagcaaagggcagaccaaa
ctcctgcagctgctgaccaccaagtccgaccagatggagccttcacccttgcccagctcc
ttgtcggacacaaacaaggactcaacagggagcttgcctgggcctgggtccacgcatggc
acctcgctcaaggagaagcataagattttgcacagactcttacaggacagcagttcccct
gtggacttggccaagctgacagcagaagccacaggcaaagagctgagccaggagtccagc
agcacagctcctgggtcggaagtgactgtcaaacaggagccagcgagccccaagaagaaa
gagaatgcactactgcgctatttgctcgacaaagatgatactaaagatattggtttaccg
gaaataacccccaaactcgagcgactggacagtaagacagatcctgccagtaacacaaag
ttaattgctatgaaaactgtgaaggaggaggtgagctttgagcccagtgaccagcctggc
agcgagctggacaacttggaagagattttggatgatttgcagaacagtcagttaccacag
cttttcccagacacaaggccaggagctcctactgggtcagttgacaagcaagccatcatc
aatgacctcatgcaactcacagctgacagcagtcccgtcccacctgccggagcccagaag
gcagcactgcgcatgtcacagagcacttttaataacccacgaccagggcaactgggcagg
ttattgccaaaccagaacttaccacttgacatcactttgcaaagcccaactggtgctgga
cctttcccaccaatcagaaacagtagcccctactcagtgatacctcagccaggaatgatg
ggtaaccaagggatgctaggaagccaaggaaacttagggaacaatagcacaggaatgatt
ggcagcagcacttcccggcccagcatgccttctggggaatgggcaccacagagtccagct
gtgagagtcacttgtgctgctaccactggtgccatgaaccgaccagtccaaggaggcatg
attcggaacccaacagccagcatccccatgcgagccaacagccagcctggccaaagacag
atgcttcagtctcaggtcatgaacataggcccttctgagttagagatgaacatgggagga
cctcagtataatcaacagcaggcccctccgaaccaaactgccccgtggcctgagagcatc
ctgcctatagaccaggcatcgtttgccagccagaacaggcagcccttcggcagctcccct
gatgacctgctgtgtccacatcctgcagcagagtcgccaagcgatgagggcgctcttctt
gaccagctgtatctggccttgcggaacttcgatggccttgaggagattgatagagctctg
gggataccagaactggtcagccagagccaagctgtggatgcagagcagttctcaagtcag
gagtccagcataatgctggagcagaagccccccgttttcccacagcagtacgcatctcag
gcacaaatggcccagggtggctataatcccatgcaagatccaaactttcacaccatggga
cagcggccaaattacaccacactccgtatgcagccacggccaggcctcaggcccacaggc
attgtgcagaaccagccaaaccaactgagacttcagcttcagcaccgcctccaagcacag
cagaatcgccagccgcttatgaatcagatcagcagtgtttccaatgtgaacctgactctg
aggcctggagtgcccactcaggctcctattaatgcacagatgctggcccagaggcagagg
gaaatcctcaaccaacatcttcggcagagacagatgcagcagcaggtgcagcagcggact
ttgatgatgagaggacagggcttgaatgtgaccccaagcatggtggctcccgctggccta
ccagcagccatgagcaatccccggatcccccaggccaatgcccagcagttcccatttcct
ccgaactacggaataagtcaacaacctgatcctggctttactggggctacaactccccag
agtcctctaatgtctccccggatggcacatactcagagtcccatgatgcagcagtctcaa
gccaacccagcctaccagcccacctcagacatgaatggatgggcacaggggagcatgggt
ggaaacagcatgttctcacagcagtccccaccacactttgggcaacaagcaaacaccagc
atgtatagtaacaacatgaacatcagtgtgtcgatggcaaccaacacgggtggcttgagc
agcatgaaccagatgacaggccagatgagcatgacctcagtgacctccgtgcctacgtca
ggactgccctccatgggtcccgagcaggtcaatgaccctgctctgaggggaggcaacctt
ttcccaaaccaactgcctggaatggacatgatcaagcaggagggagatgcatctcggaaa
tactgctga

DBGET integrated database retrieval system