KEGG   Mus musculus (house mouse): 17984
Entry
17984             CDS       T01002                                 
Symbol
Ndn, AI528698, Peg6
Name
(RefSeq) necdin, MAGE family member
  KO
K19482  necdin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    17984 (Ndn)
SSDB
Motif
Pfam: MAGE
Other DBs
NCBI-GeneID: 17984
NCBI-ProteinID: NP_035012
MGI: 97290
Ensembl: ENSMUSG00000033585
UniProt: P25233
Position
7:61998025..61999676
AA seq 325 aa
MSEQSKDLSDPNFAAEVPDCEMQDSDAVPVGIPPPASLAANLAGPPCAPEGPMAAQQASP
PPEERIEDVDPKILQQAAEEGRAHQPQSPARPIPAPPAPAQLVQKAHELMWYVLVKDQKR
MVLWFPDMVKEVMGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEEL
DRVALNNRMPMTGLLLMILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTFGDVRKIIT
EEFVQQNYLKYQRVPHIEPPEYEFFWGSRANREITKMQIMEFLARVFKKDPQAWPSRYRE
ALEQARALREANLAAQAPRSSVSED
NT seq 978 nt   +upstreamnt  +downstreamnt
atgtcggaacaaagtaaggacctgagcgaccctaactttgcagccgaggtccccgactgt
gagatgcaggacagcgatgccgttccggtggggatccctcctcccgcttctctggccgct
aacctcgcagggccaccgtgcgctcccgaaggccctatggcagcccaacaggcctcgcca
ccgcccgaagaacggatagaagatgttgaccctaaaatcctgcagcaggccgcagaggag
ggccgcgcccaccagccccagagtccagcccggccgatcccagcaccgccagcccctgcc
cagctggtgcagaaggcgcacgagctcatgtggtacgtgttggtgaaggaccagaagagg
atggtcctctggtttccagacatggtgaaagaggtcatgggcagctacaagaaatggtgc
agaagcatcctcaggcgcaccagcgtcatcctcgccagagtgttcgggctgcacctgagg
ctgaccaatctccacaccatggagtttgccctggtcaaagccctcagcccagaggagcta
gacagggtggcgctcaacaaccgtatgcccatgacaggcctcctgctcatgatcctgagc
ctcatctatgtgaagggccgcggggccagagagggtgcggtctggaatgtgctgcgcatc
ctggggctgaggccctggaagaagcactccaccttcggagacgtgaggaagataatcacc
gaggagttcgtccagcagaattacctgaagtaccagcgtgtgccccacatcgagcctccc
gagtacgagttcttctgggggtccagagctaaccgtgaaatcaccaagatgcagatcatg
gagttcctggccagagtcttcaagaaagatccccaggcgtggccttcccgatacagggag
gctctggagcaggccagagctctgcgggaggctaatcttgctgcccaggccccccgcagc
agtgtctctgaggactaa

DBGET integrated database retrieval system